Comparing SM_b20326 FitnessBrowser__Smeli:SM_b20326 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
38% identity, 90% coverage: 21:316/328 of query aligns to 1:276/285 of 7cagA
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
27% identity, 85% coverage: 22:299/328 of query aligns to 23:286/313 of P94529
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
28% identity, 68% coverage: 103:324/328 of query aligns to 282:514/514 of P02916
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
29% identity, 65% coverage: 103:314/328 of query aligns to 267:489/490 of 4ki0F
>SM_b20326 FitnessBrowser__Smeli:SM_b20326
MTDLSLADRPAALAHGGRIGSDLQAQRVRSAWLFLAPTFLVLALVAGWPLIRTIYFSFTN
ASLTNLSGAEFVGFANYLSWITLKSGRTIYRGLLADPAWWNAVWNTLKFTVLSVSIETAL
GLIVALVLNAQFPGRGLVRAAILIPWAIPTIVSAKMWAWMLNDQFGILNDMLIGLGLIGE
KIAWTASPDTAMIAELIVDVWKTTPFMALLILAGLQMVPGDIYEAAKIDGVHPVRVFWRV
TLPLIRPALMVAVIFRMLDALRIFDLIYVLTPNNAQTKTMSVMARENLFDFDKFAYGAAA
STMLFLIIATITILYMWLGRLNLSGGER
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory