Comparing SM_b20327 FitnessBrowser__Smeli:SM_b20327 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
31% identity, 97% coverage: 8:276/276 of query aligns to 12:281/281 of P94530
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
35% identity, 76% coverage: 68:276/276 of query aligns to 85:296/296 of P68183
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
26% identity, 77% coverage: 7:219/276 of query aligns to 7:237/285 of 7cagA
>SM_b20327 FitnessBrowser__Smeli:SM_b20327
MVVAIAKRTAFYALVAVIILVAVFPFYYAILTSLKSGTALFRIDYWPTDISLANYAGIFS
HGTFVRNLGNSLLVATLVVAISLLLAVTAAYALARVRFRGRGLLLLTILSVSMFPQIAVL
AGLFELIRFVGIFNTPLALIFSYMIFTLPFTVWVLTTFMRDLPIEIEEAAIVDGASPWVV
ITRVFMPLMWPALVTTGLLAFIAAWNEFLFALTFTSSNTQRTVPVAIALLSGGSQFEIPW
GNIMAASVIVTVPLVVLVLIFQRRIISGLTAGGVKG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory