SitesBLAST
Comparing SM_b20342 FitnessBrowser__Smeli:SM_b20342 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
32% identity, 91% coverage: 59:731/737 of query aligns to 14:718/732 of 8gy3C
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): M38 (= M81), G39 (= G82), Q40 (= Q83), H41 (≠ G84), V42 (≠ S85), A45 (≠ G88), G79 (= G129), G80 (= G130), S81 (= S131), S83 (= S133), V84 (≠ M134), G374 (≠ S412), F375 (= F413), L379 (≠ F419), L499 (≠ W533), R500 (= R534), V624 (≠ I637), D625 (≠ N638), Q632 (= Q645), T687 (≠ S700), G688 (= G701), L689 (≠ I702), G690 (= G703), E691 (= E704)
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
28% identity, 48% coverage: 214:565/737 of query aligns to 13:381/731 of 5g5gC
Sites not aligning to the query:
- active site: 692, 693
- binding pterin cytosine dinucleotide: 468, 469, 470, 507, 509, 511, 512, 617, 618, 621, 625, 688, 690, 691, 692
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 32% coverage: 333:565/737 of query aligns to 163:381/732 of P77489
Sites not aligning to the query:
- 440 mutation R->H,K: Decrease in catalytic efficiency.
- 468:470 binding
- 511:512 binding
- 615:621 binding
- 625 binding
- 688:691 binding
- 692 E→Q: Loss of activity.
3hrdE Crystal structure of nicotinate dehydrogenase (see paper)
24% identity, 49% coverage: 207:565/737 of query aligns to 3:381/420 of 3hrdE
- active site: Q207 (= Q382), L242 (≠ A417), R318 (≠ G506), H322 (≠ L510), R350 (= R534)
- binding calcium ion: T206 (≠ H381), N208 (≠ L383), D212 (≠ Y387), K241 (≠ R416), L242 (≠ A417), D243 (= D422)
- binding pterin cytosine dinucleotide: G237 (≠ S412), F238 (= F413), R350 (= R534)
- binding selenium atom: F238 (= F413), A348 (≠ W532), F349 (≠ W533), R350 (= R534)
3hrdA Crystal structure of nicotinate dehydrogenase (see paper)
24% identity, 49% coverage: 207:565/737 of query aligns to 3:381/420 of 3hrdA
- active site: Q207 (= Q382), L242 (≠ A417), R318 (≠ G506), H322 (≠ L510), R350 (= R534)
- binding pterin cytosine dinucleotide: G236 (= G411), G237 (≠ S412), F238 (= F413), R350 (= R534)
- binding magnesium ion: T206 (≠ H381), N208 (≠ L383), D212 (≠ Y387), K241 (≠ R416), L242 (≠ A417), D243 (= D422), T305 (≠ G493), Y308 (≠ Q496), A309 (≠ N497), S346 (≠ L531)
- binding nicotinic acid: A314 (≠ T502), R318 (≠ G506), F352 (≠ V536)
- binding selenium atom: F238 (= F413), G239 (= G414), A348 (≠ W532), F349 (≠ W533), R350 (= R534)
Q0QLF2 Nicotinate dehydrogenase large molybdopterin subunit; NDH; Nicotinic acid hydroxylase large molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see 2 papers)
24% identity, 49% coverage: 207:565/737 of query aligns to 4:382/425 of Q0QLF2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2:425 modified: mature protein, Nicotinate dehydrogenase large molybdopterin subunit
1t3qB Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
23% identity, 48% coverage: 209:564/737 of query aligns to 12:401/786 of 1t3qB
Sites not aligning to the query:
- active site: 743, 744
- binding pterin cytosine dinucleotide: 506, 507, 508, 510, 513, 545, 547, 549, 550, 666, 670, 674, 675, 678, 739, 740, 741, 742
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
30% identity, 32% coverage: 333:565/737 of query aligns to 156:375/748 of 5y6qC
Sites not aligning to the query:
- active site: 715, 716
- binding pterin cytosine dinucleotide: 461, 462, 463, 464, 468, 500, 502, 503, 504, 505, 638, 640, 641, 648, 711, 713, 714, 715
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
26% identity, 52% coverage: 220:603/737 of query aligns to 11:435/761 of 1rm6A
Sites not aligning to the query:
- active site: 718, 719
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 473, 474, 475, 476, 513, 514, 515, 517, 518, 646, 647, 651, 654, 714, 715, 716, 717, 718
1zxiB Reconstituted co dehydrogenase from oligotropha carboxidovorans (see paper)
24% identity, 48% coverage: 217:572/737 of query aligns to 21:422/804 of 1zxiB
- active site: Q235 (= Q382), V270 (≠ A417), P347 (vs. gap), I353 (vs. gap), R382 (≠ W533), C383 (≠ R534)
- binding copper (ii) ion: C383 (≠ R534), S384 (= S535)
- binding cu(i)-s-mo(vi)(=o)oh cluster: F266 (= F413), G267 (= G414), A380 (≠ L531), Y381 (≠ W532), R382 (≠ W533), C383 (≠ R534)
- binding pterin cytosine dinucleotide: G265 (≠ S412), F266 (= F413), R382 (≠ W533)
Sites not aligning to the query:
- active site: 758, 759
- binding copper (ii) ion: 758
- binding cu(i)-s-mo(vi)(=o)oh cluster: 563, 564, 758
- binding pterin cytosine dinucleotide: 523, 524, 525, 527, 530, 562, 563, 565, 567, 568, 681, 685, 689, 690, 693, 754, 755, 756, 758
1n62B Crystal structure of the mo,cu-co dehydrogenase (codh), n- butylisocyanide-bound state (see paper)
24% identity, 48% coverage: 217:572/737 of query aligns to 21:422/804 of 1n62B
- active site: Q235 (= Q382), V270 (≠ A417), P347 (vs. gap), I353 (vs. gap), R382 (≠ W533), C383 (≠ R534)
- binding cu(i)-s-mo(iv)(=o)o-nbic cluster: G267 (= G414), V379 (= V530), A380 (≠ L531), R382 (≠ W533), C383 (≠ R534), F385 (≠ V536)
- binding pterin cytosine dinucleotide: G265 (≠ S412), F266 (= F413), R382 (≠ W533)
Sites not aligning to the query:
- active site: 758, 759
- binding cu(i)-s-mo(iv)(=o)o-nbic cluster: 563, 564, 758
- binding pterin cytosine dinucleotide: 523, 524, 525, 527, 530, 562, 563, 564, 565, 567, 568, 681, 685, 689, 690, 693, 754, 755, 756, 757, 758
1n5wB Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
24% identity, 48% coverage: 217:572/737 of query aligns to 21:422/804 of 1n5wB
- active site: Q235 (= Q382), V270 (≠ A417), P347 (vs. gap), I353 (vs. gap), R382 (≠ W533), C383 (≠ R534)
- binding cu(i)-s-mo(vi)(=o)oh cluster: G267 (= G414), A380 (≠ L531), R382 (≠ W533), C383 (≠ R534)
- binding pterin cytosine dinucleotide: G265 (≠ S412), F266 (= F413), R382 (≠ W533)
Sites not aligning to the query:
- active site: 758, 759
- binding cu(i)-s-mo(vi)(=o)oh cluster: 563, 564, 758
- binding pterin cytosine dinucleotide: 523, 524, 525, 527, 530, 562, 563, 565, 567, 568, 681, 685, 689, 690, 693, 754, 755, 756, 758
1n63B Crystal structure of the cu,mo-co dehydrogenase (codh); carbon monoxide reduced state (see paper)
24% identity, 48% coverage: 217:572/737 of query aligns to 22:423/805 of 1n63B
- active site: Q236 (= Q382), V271 (≠ A417), P348 (vs. gap), I354 (vs. gap), R383 (≠ W533), C384 (≠ R534)
- binding cu(i)-s-mo(iv)(=o)oh cluster: G268 (= G414), A381 (≠ L531), R383 (≠ W533), C384 (≠ R534)
- binding pterin cytosine dinucleotide: G266 (≠ S412), F267 (= F413), R383 (≠ W533)
Sites not aligning to the query:
- active site: 759, 760
- binding cu(i)-s-mo(iv)(=o)oh cluster: 564, 565, 759
- binding pterin cytosine dinucleotide: 524, 525, 526, 528, 531, 563, 564, 566, 568, 569, 682, 686, 690, 691, 694, 755, 756, 757, 759
1n60B Crystal structure of the cu,mo-co dehydrogenase (codh); cyanide- inactivated form (see paper)
24% identity, 48% coverage: 217:572/737 of query aligns to 20:421/803 of 1n60B
Sites not aligning to the query:
- active site: 757, 758
- binding pterin cytosine dinucleotide: 522, 523, 524, 526, 529, 561, 562, 563, 564, 566, 567, 680, 684, 688, 689, 692, 753, 754, 755, 757
- binding mo(vi)(=o)(oh)2 cluster: 562, 563, 757
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
26% identity, 52% coverage: 220:603/737 of query aligns to 19:443/769 of O33819
Sites not aligning to the query:
- 522:526 binding
- 650:655 binding
- 722:725 binding
8emtB Cryo-em analysis of the human aldehyde oxidase from liver (see paper)
26% identity, 30% coverage: 253:475/737 of query aligns to 530:752/1221 of 8emtB
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 210, 211, 213, 214, 216, 217, 218, 291, 292, 300, 304, 305, 307, 314
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 42, 44, 45, 47, 69, 109, 112, 144, 146
3hrdB Crystal structure of nicotinate dehydrogenase (see paper)
34% identity, 17% coverage: 607:731/737 of query aligns to 183:316/330 of 3hrdB
- active site: E289 (= E704), P290 (= P705)
- binding pterin cytosine dinucleotide: I215 (= I637), N216 (= N638), M219 (≠ Q641), V220 (= V642), Q223 (= Q645), K285 (≠ S700), G286 (= G701), V287 (≠ I702), G288 (= G703), E289 (= E704)
Sites not aligning to the query:
Q0QLF1 Nicotinate dehydrogenase medium molybdopterin subunit; NDH; Nicotinic acid hydroxylase medium molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
34% identity, 17% coverage: 607:731/737 of query aligns to 183:316/330 of Q0QLF1
- 211:223 (vs. 633:645, 38% identical) binding
- AKGVGE 284:289 (≠ -SGIGE 700:704) binding
Sites not aligning to the query:
- 45:49 binding
- 85:90 binding
2e1qA Crystal structure of human xanthine oxidoreductase mutant, glu803val (see paper)
24% identity, 50% coverage: 197:564/737 of query aligns to 529:917/1307 of 2e1qA
- active site: Q742 (= Q382), V777 (= V418), R855 (≠ K488), H859 (≠ D492), R887 (= R534)
- binding bicarbonate ion: R814 (= R456), H815 (≠ P457), I852 (= I485), F886 (≠ W533), F889 (≠ V536), G890 (= G537), Q893 (≠ H540)
- binding calcium ion: E715 (≠ A356), H716 (= H357), Y718 (≠ A359), T741 (≠ H381), T747 (≠ Y387), S780 (≠ G421), T781 (≠ D422), S784 (≠ V425), T811 (≠ G453), G812 (≠ R454)
- binding fe2/s2 (inorganic) cluster: L719 (= L360)
- binding hydroxy(dioxo)molybdenum: F773 (= F413), G774 (= G414), R887 (= R534)
Sites not aligning to the query:
- active site: 1235, 1236
- binding flavin-adenine dinucleotide: 43, 44, 230, 231, 232, 233, 234, 235, 236, 237, 238, 311, 312, 316, 320, 321, 324, 325, 327, 328, 333, 334, 377, 378
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
- binding hydroxy(dioxo)molybdenum: 1053, 1054, 1236
P47989 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Homo sapiens (Human) (see 4 papers)
24% identity, 50% coverage: 197:564/737 of query aligns to 555:943/1333 of P47989
- P555 (= P197) to S: in dbSNP:rs45577338
- D584 (≠ A222) to A: in dbSNP:rs45491693
- R607 (≠ V244) to Q: in dbSNP:rs45442092
- K617 (= K254) to N: in dbSNP:rs45442398
- T623 (≠ A260) to I: in dbSNP:rs45448694
- I646 (≠ V281) to V: in dbSNP:rs17323225
- I703 (vs. gap) to V: in dbSNP:rs17011368
- L763 (≠ I377) to F: in a breast cancer sample; somatic mutation
- R791 (≠ N405) to G: in a breast cancer sample; somatic mutation; dbSNP:rs775646772
- T910 (≠ I514) to M: in dbSNP:rs669884
Sites not aligning to the query:
- 133 E → K: in dbSNP:rs45447191
- 172 G → R: in dbSNP:rs45523133
- 235 T → M: in dbSNP:rs45469499
- 257:264 binding
- 337 binding
- 347:351 binding
- 360 binding
- 395 K → M: in dbSNP:rs34929837
- 422 binding
- 509 modified: Disulfide link with 1318, In oxidase form
- 536 modified: Disulfide link with 993, In oxidase form
- 993 modified: Disulfide link with 536, In oxidase form
- 1091 V → L: in dbSNP:rs45619033
- 1109 N → T: in dbSNP:rs45547640
- 1150 P → R: in dbSNP:rs1042036
- 1176 R → C: in dbSNP:rs45624433
- 1296 R → W: in dbSNP:rs45564939
- 1318 modified: Disulfide link with 509, In oxidase form
Query Sequence
>SM_b20342 FitnessBrowser__Smeli:SM_b20342
MIPKLMQSITLPVARAEASRRQFLLGALAAGTGVAIGYRILSASPALAGEAATESGSHAF
SPYLTIGGDGKVTVLSSQFEMGQGSYNGIATLVAEELDSDWSAIDVIGAAGNIKAYGNIA
FGGTMQGTGGSTSMSTSWERYRRAGAAARAMLVAAAAAEWGVDAAEIAVENGVLSHPSGK
SGGFGAFAAKAATMPVPADVKLKEPGDWKLIGNDELKRFDSARKANGTEQYTIDVKLPGM
LTAVMIHPPLFGAKAKSFDASAARAIKGVVDVVETPRGIAVVGEHMWAAIKGREAVTVEW
DETGAEKRGTPELMSTYRDLAGKSPAAFARKDGDTDAAFTSAAKVIEATFEFPYLAHAAL
EPLNAVARRNDDGTIEIWGGHQLPDVYQNLASEIAGVPVEKVRLNVMKTGGSFGRRAVFD
GDVVVEAVHVAKALGFRAPVKVQWTREEDTRAGRYRPAYVHRLKAGIDEAGKLVAWSDHI
VGQSIMAKTAWDGMVQNGVDPTSVEGANNLPYAIANQTVGLTTTDVRVPVLWWRSVGSTH
TAFAAEAFLDEVAEAAGRDPLEFRLSMLEPDSRHATVLKLAAEKAEWQKPLPEGRFRGVA
VAESFGSVVAQIAEVSVDGDGIKVERVVAAVDCGLAINPDQVRAQVEGGIGFGLSAILGE
EITLTDGKVDQGNFDMYTPLRIDAMPKVEVHIVASANPPSGIGEPGVPPIGPAVANAAFK
ALGKRIRVMPFAKSLNA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory