Comparing SM_b20349 FitnessBrowser__Smeli:SM_b20349 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
87% identity, 91% coverage: 27:311/313 of query aligns to 2:286/287 of 5ibqA
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
87% identity, 91% coverage: 27:311/313 of query aligns to 2:286/287 of 4ry0A
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
41% identity, 89% coverage: 30:309/313 of query aligns to 4:289/292 of 2fn8A
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
37% identity, 82% coverage: 30:286/313 of query aligns to 3:258/274 of 2ioyA
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
33% identity, 75% coverage: 28:263/313 of query aligns to 2:235/271 of 1dbpA
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
32% identity, 83% coverage: 30:288/313 of query aligns to 5:260/270 of 4zjpA
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
31% identity, 82% coverage: 30:287/313 of query aligns to 5:270/287 of 5dteB
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
28% identity, 89% coverage: 26:305/313 of query aligns to 6:281/284 of 7e7mC
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
29% identity, 77% coverage: 67:307/313 of query aligns to 46:284/287 of 4yo7A
Sites not aligning to the query:
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
31% identity, 82% coverage: 6:263/313 of query aligns to 2:269/349 of A0QYB5
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
32% identity, 71% coverage: 41:263/313 of query aligns to 15:237/315 of 4rsmA
Sites not aligning to the query:
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
31% identity, 71% coverage: 41:263/313 of query aligns to 47:269/349 of A0QYB3
Sites not aligning to the query:
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
31% identity, 71% coverage: 41:263/313 of query aligns to 14:236/315 of 4rs3A
Sites not aligning to the query:
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
31% identity, 71% coverage: 41:263/313 of query aligns to 14:236/314 of 5hkoA
Sites not aligning to the query:
4rxmB Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
31% identity, 77% coverage: 28:267/313 of query aligns to 3:246/288 of 4rxmB
4rxmA Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
31% identity, 77% coverage: 28:267/313 of query aligns to 5:248/291 of 4rxmA
Sites not aligning to the query:
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
32% identity, 64% coverage: 40:240/313 of query aligns to 15:223/297 of 4ry9B
Sites not aligning to the query:
4ry9A Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
32% identity, 64% coverage: 40:240/313 of query aligns to 15:223/297 of 4ry9A
Sites not aligning to the query:
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
27% identity, 86% coverage: 31:298/313 of query aligns to 5:286/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
27% identity, 86% coverage: 31:298/313 of query aligns to 5:286/288 of 1gudA
Sites not aligning to the query:
>SM_b20349 FitnessBrowser__Smeli:SM_b20349
MKLTRRMTITAFAAVLAASSAVPAYAADLIAIITPSHDNPFFKAEAVGAEAKAKELGYET
LVLVHDDDANKQSQLIDTAIGRGAKAIILDNAGSEASIAAVQKAKDAGVPSFLIDREINA
TGVAVSQIVSNNYQGAQLGAEEFVKLMGESGNYVELLGREADLNAGIRSKGYHDVIDEYP
EMKMVAQQSANWSQTEGYSKMETILQANPDIKGVISGNDTMAMGAIAALQAAGRKDVIVV
GFDGSNDVRDSIKSGGIKATVLQPAYAQAQMAVQQAHEYITTGKAPAEEKQLMDCVLINS
ENADQLETFALAD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory