Comparing SM_b20362 FitnessBrowser__Smeli:SM_b20362 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6tqoT Rrn anti-termination complex (see paper)
36% identity, 77% coverage: 44:249/266 of query aligns to 27:235/255 of 6tqoT
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
35% identity, 79% coverage: 41:249/266 of query aligns to 36:247/270 of 6ib8B
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
35% identity, 79% coverage: 41:249/266 of query aligns to 32:243/267 of P0ADG4
Sites not aligning to the query:
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
35% identity, 79% coverage: 41:249/266 of query aligns to 32:243/262 of 2qflA
3luzA Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
38% identity, 70% coverage: 46:232/266 of query aligns to 24:205/238 of 3luzA
Sites not aligning to the query:
2p3nA Thermotoga maritima impase tm1415 (see paper)
32% identity, 89% coverage: 12:248/266 of query aligns to 3:232/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
32% identity, 89% coverage: 12:248/266 of query aligns to 3:232/256 of O33832
3luzB Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
38% identity, 71% coverage: 43:232/266 of query aligns to 22:201/234 of 3luzB
Sites not aligning to the query:
3lv0A Crystal structure of extragenic suppressor protein suhb from bartonella henselae, native
38% identity, 71% coverage: 43:232/266 of query aligns to 33:223/258 of 3lv0A
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 80% coverage: 47:260/266 of query aligns to 42:261/271 of Q9M8S8
5dw8A Crystal structure of 2'amp bound saimpase-ii
33% identity, 70% coverage: 46:231/266 of query aligns to 26:212/260 of 5dw8A
P9WKI9 Inositol-1-monophosphatase SuhB; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 83% coverage: 39:260/266 of query aligns to 46:275/290 of P9WKI9
2bjiA High resolution structure of myo-inositol monophosphatase, the target of lithium therapy (see paper)
33% identity, 82% coverage: 16:234/266 of query aligns to 10:234/274 of 2bjiA
5yhtA Crystal structure of a phosphatase from mycobacterium tuberculosis in complex with its substrate (see paper)
36% identity, 73% coverage: 37:231/266 of query aligns to 26:223/255 of 5yhtA
P20456 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Bos taurus (Bovine) (see paper)
33% identity, 82% coverage: 16:234/266 of query aligns to 12:236/277 of P20456
P95189 Histidinol-phosphatase; HolPase; Histidinol-phosphate phosphatase; EC 3.1.3.15 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 73% coverage: 37:231/266 of query aligns to 29:226/260 of P95189
5zonA Histidinol phosphate phosphatase from mycobacterium tuberculosis (see paper)
36% identity, 73% coverage: 37:231/266 of query aligns to 27:224/256 of 5zonA
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
33% identity, 81% coverage: 16:231/266 of query aligns to 8:229/266 of 1imdA
2hhmA Structure of inositol monophosphatase, the putative target of lithium therapy (see paper)
33% identity, 81% coverage: 16:231/266 of query aligns to 8:229/272 of 2hhmA
1imbA Structural analysis of inositol monophosphatase complexes with substrates (see paper)
33% identity, 81% coverage: 16:231/266 of query aligns to 8:229/272 of 1imbA
>SM_b20362 FitnessBrowser__Smeli:SM_b20362
MTSHVVPGLEARLALAETIGREAGAMALDFFARRETLIIETKRDPQDLVSIADREVENLI
RDRIAEAYPEDGVLGEEYGLVPGRSGFTWAVDPIDGTSPFVNGMPNWCVSIALVHAGIPV
VGVIAAPCHGELYAAALGLGARLNGKALTLDGSRTIRNHVTGLGANNYVKPAFVGQMVES
LLEAGGTFMRNGSGALMLAYVAAGRLVGYYEPYMHAWDCLAGYCLVQEAGGWYLPFPTEG
ESLTRGSIVLAAAPGAVEDLRKLAGV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory