SitesBLAST
Comparing SM_b20432 FitnessBrowser__Smeli:SM_b20432 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
36% identity, 93% coverage: 7:315/334 of query aligns to 5:312/322 of 3l6bA
- active site: K54 (= K56), S77 (≠ T81), E203 (≠ T207), A207 (≠ G211), D209 (≠ A213), G232 (≠ S235), T278 (≠ A284), L305 (≠ I308), S306 (= S309)
- binding malonate ion: K54 (= K56), S76 (= S80), S77 (≠ T81), N79 (= N83), H80 (= H84), R128 (≠ Q133), G232 (≠ S235)
- binding manganese (ii) ion: E203 (≠ T207), A207 (≠ G211), D209 (≠ A213)
- binding pyridoxal-5'-phosphate: F53 (= F55), K54 (= K56), N79 (= N83), G178 (≠ S182), G179 (= G183), G180 (= G184), G181 (= G185), M182 (≠ L186), V233 (≠ L236), E276 (= E282), T278 (≠ A284), S306 (= S309), G307 (= G310)
6zspAAA serine racemase bound to atp and malonate. (see paper)
35% identity, 93% coverage: 7:315/334 of query aligns to 4:309/320 of 6zspAAA
- active site: K53 (= K56), S74 (≠ T81), E200 (≠ T207), A204 (≠ G211), D206 (≠ A213), G229 (≠ S235), L302 (≠ I308), S303 (= S309)
- binding adenosine-5'-triphosphate: S28 (= S31), S29 (≠ G32), I30 (≠ S33), K48 (≠ T51), T49 (= T52), Q79 (≠ R86), Y111 (≠ L118), E266 (≠ A275), R267 (≠ E276), K269 (≠ R278), N306 (= N312)
- binding magnesium ion: E200 (≠ T207), A204 (≠ G211), D206 (≠ A213)
- binding malonate ion: K53 (= K56), S73 (= S80), S74 (≠ T81), N76 (= N83), H77 (= H84), R125 (≠ Q133), G229 (≠ S235), S232 (≠ G238)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
36% identity, 92% coverage: 7:314/334 of query aligns to 4:310/310 of 7nbgDDD
- active site: K53 (= K56), S76 (≠ T81), E202 (≠ T207), A206 (≠ G211), D208 (≠ A213), G231 (≠ S235), L304 (≠ I308), S305 (= S309)
- binding calcium ion: E202 (≠ T207), A206 (≠ G211), D208 (≠ A213)
- binding magnesium ion: N239 (≠ D243)
- binding ortho-xylene: S76 (≠ T81), Q81 (≠ R86), I96 (= I101), Y113 (≠ L118)
- binding pyridoxal-5'-phosphate: F52 (= F55), K53 (= K56), N78 (= N83), G177 (≠ S182), G178 (= G183), G179 (= G184), G180 (= G185), M181 (≠ L186), G231 (≠ S235), V232 (≠ L236), E275 (= E282), T277 (≠ A284), S305 (= S309), G306 (= G310)
Sites not aligning to the query:
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
35% identity, 93% coverage: 7:315/334 of query aligns to 4:316/323 of 7nbfAAA
- active site: K53 (= K56), S81 (≠ T81), E207 (≠ T207), A211 (≠ G211), D213 (≠ A213), G236 (≠ S235), L309 (≠ I308), S310 (= S309)
- binding calcium ion: E207 (≠ T207), A211 (≠ G211), D213 (≠ A213)
- binding magnesium ion: N244 (≠ D243)
- binding pyridoxal-5'-phosphate: F52 (= F55), K53 (= K56), N83 (= N83), G182 (≠ S182), G183 (= G183), G184 (= G184), G185 (= G185), M186 (≠ L186), G236 (≠ S235), V237 (≠ L236), T282 (≠ A284), S310 (= S309), G311 (= G310)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (≠ L24), L22 (≠ T25), T23 (= T26), P24 (= P27), L26 (≠ A29), T27 (≠ M30), F46 (≠ H49)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
35% identity, 93% coverage: 7:315/334 of query aligns to 4:316/323 of 7nbdAAA
- active site: K53 (= K56), S81 (≠ T81), E207 (≠ T207), A211 (≠ G211), D213 (≠ A213), G236 (≠ S235), L309 (≠ I308), S310 (= S309)
- binding calcium ion: E207 (≠ T207), A211 (≠ G211), D213 (≠ A213)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ Y274), L278 (≠ I280), V314 (= V313), L316 (≠ M315)
- binding magnesium ion: N244 (≠ D243)
- binding pyridoxal-5'-phosphate: F52 (= F55), K53 (= K56), N83 (= N83), G182 (≠ S182), G183 (= G183), G184 (= G184), G185 (= G185), M186 (≠ L186), G236 (≠ S235), V237 (≠ L236), E280 (= E282), T282 (≠ A284), S310 (= S309), G311 (= G310)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
35% identity, 93% coverage: 7:315/334 of query aligns to 4:316/323 of 7nbcCCC
- active site: K53 (= K56), S81 (≠ T81), E207 (≠ T207), A211 (≠ G211), D213 (≠ A213), G236 (≠ S235), L309 (≠ I308), S310 (= S309)
- binding biphenyl-4-ylacetic acid: T78 (≠ A78), H79 (≠ A79), H84 (= H84), V148 (= V148), H149 (≠ P149), P150 (= P150)
- binding calcium ion: E207 (≠ T207), A211 (≠ G211), D213 (≠ A213)
- binding pyridoxal-5'-phosphate: F52 (= F55), K53 (= K56), N83 (= N83), G182 (≠ S182), G183 (= G183), G184 (= G184), G185 (= G185), M186 (≠ L186), G236 (≠ S235), V237 (≠ L236), T282 (≠ A284), S310 (= S309), G311 (= G310)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
35% identity, 93% coverage: 7:315/334 of query aligns to 4:316/323 of 7nbcAAA
- active site: K53 (= K56), S81 (≠ T81), E207 (≠ T207), A211 (≠ G211), D213 (≠ A213), G236 (≠ S235), L309 (≠ I308), S310 (= S309)
- binding calcium ion: E207 (≠ T207), A211 (≠ G211), D213 (≠ A213)
- binding magnesium ion: N244 (≠ D243)
- binding pyridoxal-5'-phosphate: F52 (= F55), K53 (= K56), N83 (= N83), G182 (≠ S182), G183 (= G183), G184 (= G184), G185 (= G185), M186 (≠ L186), G236 (≠ S235), V237 (≠ L236), T282 (≠ A284), S310 (= S309), G311 (= G310)
Sites not aligning to the query:
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
35% identity, 93% coverage: 7:315/334 of query aligns to 4:316/322 of 7nbgAAA
- active site: K53 (= K56), S81 (≠ T81), E207 (≠ T207), A211 (≠ G211), D213 (≠ A213), G236 (≠ S235), L309 (≠ I308), S310 (= S309)
- binding calcium ion: E207 (≠ T207), A211 (≠ G211), D213 (≠ A213)
- binding pyridoxal-5'-phosphate: F52 (= F55), K53 (= K56), N83 (= N83), G182 (≠ S182), G183 (= G183), G184 (= G184), G185 (= G185), M186 (≠ L186), G236 (≠ S235), V237 (≠ L236), T282 (≠ A284), S310 (= S309), G311 (= G310)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ T81), G85 (= G85), Q86 (≠ R86), I101 (= I101), K111 (= K111), I115 (= I115), Y118 (≠ L118)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
35% identity, 93% coverage: 7:315/334 of query aligns to 4:316/320 of 7nbhAAA
- active site: K53 (= K56), S81 (≠ T81), E207 (≠ T207), A211 (≠ G211), D213 (≠ A213), G236 (≠ S235), L309 (≠ I308), S310 (= S309)
- binding calcium ion: E207 (≠ T207), A211 (≠ G211), D213 (≠ A213)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ T81), G85 (= G85), Q86 (≠ R86), K111 (= K111), I115 (= I115), Y118 (≠ L118), D235 (= D234), P281 (≠ G283), N313 (= N312), V314 (= V313), D315 (= D314)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
34% identity, 92% coverage: 9:315/334 of query aligns to 21:329/339 of Q7XSN8
- E219 (≠ T207) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ A213) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
36% identity, 94% coverage: 1:315/334 of query aligns to 1:315/326 of 2gn2A
- active site: K56 (= K56), A81 (≠ T81), Q207 (≠ T207), V211 (≠ G211), G213 (≠ A213), G235 (= G237), I308 (= I308), S309 (= S309)
- binding cytidine-5'-monophosphate: R51 (≠ T51), T52 (= T52), G53 (= G53), A114 (≠ E114), D117 (≠ R117), Y118 (≠ L118), N312 (= N312)
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
32% identity, 95% coverage: 8:324/334 of query aligns to 5:319/319 of A4F2N8
- K53 (= K56) mutation to A: Loss of enzymatic activity.
5cvcA Structure of maize serine racemase (see paper)
34% identity, 92% coverage: 9:315/334 of query aligns to 5:313/329 of 5cvcA
- active site: K52 (= K56), S77 (≠ T81), E203 (≠ T207), A207 (≠ G211), D209 (≠ A213), G231 (≠ S235), V306 (≠ I308), S307 (= S309)
- binding magnesium ion: E203 (≠ T207), A207 (≠ G211), D209 (≠ A213)
- binding pyridoxal-5'-phosphate: F51 (= F55), K52 (= K56), N79 (= N83), S178 (= S182), G179 (= G183), G180 (= G184), G181 (= G185), L232 (= L236), E275 (= E282), S307 (= S309), G308 (= G310)
Q9QZX7 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Mus musculus (Mouse) (see paper)
32% identity, 94% coverage: 1:315/334 of query aligns to 1:319/339 of Q9QZX7
- C113 (≠ N110) modified: S-nitrosocysteine; mutation to S: Abolishes S-nitrosylation.
3hmkA Crystal structure of serine racemase (see paper)
33% identity, 93% coverage: 7:315/334 of query aligns to 5:317/321 of 3hmkA
- active site: K54 (= K56), S82 (≠ T81), E208 (≠ T207), A212 (≠ G211), D214 (≠ A213), G237 (≠ S235), T283 (≠ A284), L310 (≠ I308), S311 (= S309)
- binding manganese (ii) ion: E208 (≠ T207), A212 (≠ G211), D214 (≠ A213)
- binding pyridoxal-5'-phosphate: F53 (= F55), K54 (= K56), N84 (= N83), G183 (≠ S182), G184 (= G183), G185 (= G184), G186 (= G185), M187 (≠ L186), G237 (≠ S235), V238 (≠ L236), T283 (≠ A284), S311 (= S309), G312 (= G310)
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
31% identity, 96% coverage: 5:323/334 of query aligns to 2:317/318 of 1wtcA
- active site: K52 (= K56), S77 (≠ T81), E203 (≠ T207), G207 (= G211), D209 (≠ A213), G231 (= G237), I302 (= I308), S303 (= S309)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ L24), K47 (≠ T51), M48 (≠ T52), A109 (≠ S113), A110 (≠ E114), Y114 (≠ L118)
- binding magnesium ion: E203 (≠ T207), G207 (= G211), D209 (≠ A213)
- binding pyridoxal-5'-phosphate: F51 (= F55), K52 (= K56), N79 (= N83), G178 (≠ S182), G179 (= G183), G180 (= G184), G181 (= G185), G231 (= G237), E276 (= E282), T278 (≠ A284), S303 (= S309)
1v71A Crystal structure of s.Pombe serine racemase
31% identity, 96% coverage: 5:323/334 of query aligns to 2:317/318 of 1v71A
- active site: K52 (= K56), S77 (≠ T81), E203 (≠ T207), G207 (= G211), D209 (≠ A213), G231 (= G237), I302 (= I308), S303 (= S309)
- binding magnesium ion: E203 (≠ T207), G207 (= G211), D209 (≠ A213)
- binding pyridoxal-5'-phosphate: F51 (= F55), K52 (= K56), N79 (= N83), G178 (≠ S182), G179 (= G183), G180 (= G184), G181 (= G185), G231 (= G237), E276 (= E282), T278 (≠ A284), S303 (= S309), G304 (= G310)
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
31% identity, 96% coverage: 5:323/334 of query aligns to 3:318/319 of 2zr8A
- active site: K53 (= K56), S78 (≠ T81), E204 (≠ T207), G208 (= G211), D210 (≠ A213), G232 (= G237), I303 (= I308), S304 (= S309)
- binding magnesium ion: E204 (≠ T207), G208 (= G211), D210 (≠ A213)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F55), K53 (= K56), S77 (= S80), S78 (≠ T81), N80 (= N83), H81 (= H84), P147 (= P150), G179 (≠ S182), G180 (= G183), G181 (= G184), G182 (= G185), G232 (= G237), E277 (= E282), T279 (≠ A284), S304 (= S309)
- binding serine: S78 (≠ T81), R129 (≠ A132), D231 (= D234), G232 (= G237), A233 (≠ G238), Q234 (≠ G239), T235 (≠ I240)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
31% identity, 96% coverage: 5:323/334 of query aligns to 3:318/319 of 2zpuA
- active site: K53 (= K56), S78 (≠ T81), E204 (≠ T207), G208 (= G211), D210 (≠ A213), G232 (= G237), I303 (= I308), S304 (= S309)
- binding magnesium ion: E204 (≠ T207), G208 (= G211), D210 (≠ A213)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F55), K53 (= K56), S77 (= S80), S78 (≠ T81), N80 (= N83), H81 (= H84), P147 (= P150), G179 (≠ S182), G180 (= G183), G181 (= G184), G182 (= G185), G232 (= G237), E277 (= E282), T279 (≠ A284), S304 (= S309)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
31% identity, 96% coverage: 5:323/334 of query aligns to 7:322/323 of O59791
- S82 (≠ T81) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
Query Sequence
>SM_b20432 FitnessBrowser__Smeli:SM_b20432
MSVSLPVTIDDIEVAARRISGRVLTTPLAMSGSLSELCGVPVGLKLEHHQTTGSFKLRGA
TNAVLSLSAGDRALGVIAASTGNHGRALAHAAKAEGSVATICMSHLVPVNKVSEIRRLGA
NVRIVGNSQDEAQEEVERLVAENGLVMVPPFDHRAIVAGQGTLGLEVVAQMPDVAMVLVP
VSGGGLAAGVAAAVKARRPATRVIGLTMERGAAMKASFAAGGPALVDEQPSLADSLGGGI
GLDNRVTFRMCRELLDDIILLTEAEIAAGMRHAYAEEREIVEGAGAVGISALLAGKIKDI
DGPIAVIISGRNVDMDLHLRVMNGETDPFREEAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory