SitesBLAST
Comparing SM_b20458 FitnessBrowser__Smeli:SM_b20458 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q6GMI9 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UXS-1; EC 4.1.1.35 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
57% identity, 91% coverage: 28:345/348 of query aligns to 86:397/418 of Q6GMI9
- R234 (= R176) mutation to H: In Man o' war (mow) mutant; characterized by severe craniofacial defects. Fishes show defective organization and morphogenesis of chondrocytes, perichondrium and bone.
Q8NBZ7 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UGD; UXS-1; hUXS; hUXS1; EC 4.1.1.35 from Homo sapiens (Human) (see 4 papers)
58% identity, 88% coverage: 28:333/348 of query aligns to 88:391/420 of Q8NBZ7
- G98 (= G38) binding
- F99 (= F39) binding
- V100 (≠ L40) binding
- D119 (= D59) binding
- N120 (= N60) binding
- F122 (≠ S62) binding
- T123 (= T63) binding
- G124 (= G64) binding
- D144 (= D84) binding
- V145 (= V85) binding
- L149 (≠ I89) binding
- Y150 (≠ D90) binding
- L159 (= L99) binding
- S161 (≠ C101) binding
- K177 (= K117) binding
- T178 (= T118) binding
- N185 (= N125) binding
- G188 (≠ D128) binding
- K191 (≠ A131) binding
- R192 (= R132) binding
- A200 (= A140) binding
- E204 (= E144) mutation to A: Reduced UDP-glucuronic acid decarboxylase activity.
- Y231 (= Y171) active site, Proton acceptor; binding ; mutation to F: Abolished UDP-glucuronic acid decarboxylase activity.
- K235 (= K175) binding
- R236 (= R176) mutation to H: Strongly reduced UDP-glucuronic acid decarboxylase activity, caused by a local unfolding of the active site that allows for a rotation of the dimer interface, leading to the formation of a homohexamer.
- Y245 (≠ F185) binding
- Q248 (≠ S188) binding
- E249 (≠ H189) binding
- T261 (= T201) binding
- H267 (≠ R207) binding
- R272 (= R212) binding
- R361 (= R303) mutation to Q: Strongly reduced UDP-glucuronic acid decarboxylase activity.
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
2b69A Crystal structure of human udp-glucoronic acid decarboxylase
58% identity, 88% coverage: 28:333/348 of query aligns to 1:304/312 of 2b69A
- active site: T115 (= T142), S116 (= S143), E117 (= E144), Y144 (= Y171), K148 (= K175), R185 (= R212)
- binding nicotinamide-adenine-dinucleotide: G8 (= G35), G11 (= G38), F12 (= F39), V13 (≠ L40), D32 (= D59), N33 (= N60), T36 (= T63), G37 (= G64), D57 (= D84), V58 (= V85), L72 (= L99), A73 (= A100), S74 (≠ C101), A76 (= A103), T91 (= T118), T115 (= T142), Y144 (= Y171), K148 (= K175), I171 (= I198), N173 (= N200), R185 (= R212)
- binding uridine-5'-diphosphate: P61 (= P88), L62 (≠ I89), Y63 (≠ D90), P78 (= P105), N98 (= N125), G101 (≠ D128), L102 (= L129), K104 (≠ A131), R105 (= R132), Y158 (≠ F185), N173 (= N200), R185 (= R212), V186 (= V213), N189 (= N216), T201 (= T228), Y203 (= Y230), Q208 (= Q235), R210 (= R237), I244 (= I273), D270 (= D299)
4lk3B Crystal structure of human udp-xylose synthase r236a substitution (see paper)
49% identity, 88% coverage: 28:333/348 of query aligns to 1:266/274 of 4lk3B
- active site: T112 (= T142), S113 (= S143), E114 (= E144), K119 (= K175), R156 (= R212)
- binding nicotinamide-adenine-dinucleotide: G8 (= G35), G11 (= G38), F12 (= F39), V13 (≠ L40), D32 (= D59), N33 (= N60), T36 (= T63), G37 (= G64), D57 (= D84), V58 (= V85), L72 (= L99), A73 (= A100), S74 (≠ C101), P75 (= P102), T88 (= T118), A110 (= A140), T112 (= T142), K119 (= K175), I142 (= I198), H151 (≠ R207)
- binding uridine-5'-diphosphate: R156 (= R212), V157 (= V213), N160 (= N216), T172 (= T228), Y174 (= Y230), Q179 (= Q235), R181 (= R237), I215 (= I273)
- binding uridine-5'-diphosphate-glucuronic acid: P61 (= P88), L62 (≠ I89), Y63 (≠ D90), I83 (= I113), K87 (= K117), N95 (= N125), G98 (≠ D128), L99 (= L129), K101 (≠ A131), Y129 (≠ F185), E133 (≠ H189)
4lk3C Crystal structure of human udp-xylose synthase r236a substitution (see paper)
49% identity, 88% coverage: 28:333/348 of query aligns to 1:263/271 of 4lk3C
- active site: T110 (= T142), S111 (= S143), E112 (= E144), K117 (= K175), R154 (= R212)
- binding nicotinamide-adenine-dinucleotide: G8 (= G35), G11 (= G38), F12 (= F39), V13 (≠ L40), D32 (= D59), N33 (= N60), T36 (= T63), G37 (= G64), D57 (= D84), V58 (= V85), L72 (= L99), A73 (= A100), S74 (≠ C101), P75 (= P102), T86 (= T118), K117 (= K175), I140 (= I198), H149 (≠ R207)
- binding pyrophosphate 2-: R154 (= R212), V155 (= V213)
- binding uridine-5'-diphosphate-glucuronic acid: P61 (= P88), L62 (≠ I89), Y63 (≠ D90), N93 (= N125), G96 (≠ D128), L97 (= L129), K99 (≠ A131), R100 (= R132), Y127 (≠ F185), E131 (≠ H189)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
33% identity, 88% coverage: 31:337/348 of query aligns to 3:308/309 of 4zrnA
- active site: T117 (≠ S141), G119 (≠ S143), A120 (≠ E144), Y143 (= Y171), K147 (= K175), Y181 (vs. gap), G185 (≠ R212)
- binding nicotinamide-adenine-dinucleotide: G7 (= G35), G10 (= G38), F11 (= F39), I12 (≠ L40), D31 (= D59), N32 (= N60), S34 (= S62), S35 (≠ T63), G36 (= G64), S51 (≠ R79), I52 (≠ V80), L73 (= L99), A74 (= A100), A75 (≠ C101), T92 (= T118), S115 (≠ Q139), S116 (≠ A140), Y143 (= Y171), K147 (= K175), Y170 (≠ I198), V173 (≠ T201)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S141), G119 (≠ S143), A120 (≠ E144), Y143 (= Y171), N172 (= N200), G185 (≠ R212), V186 (= V213), H201 (≠ T228), F203 (≠ Y230), Y208 (≠ Q235), R210 (= R237), V244 (≠ I273), R267 (≠ P296), D270 (= D299)
8vr2B Crystal structure of the pcryo_0617 oxidoreductase/decarboxylase from psychrobacter cryohalolentis k5 in the presence of NAD and udp
32% identity, 91% coverage: 29:343/348 of query aligns to 8:317/321 of 8vr2B
- binding nicotinamide-adenine-dinucleotide: G14 (= G35), G17 (= G38), F18 (= F39), I19 (≠ L40), D37 (= D59), N38 (= N60), E40 (≠ R66), R41 (= R67), N61 (≠ D84), V62 (= V85), A81 (≠ L99), A82 (= A100), A83 (≠ C101), F124 (≠ A140), K154 (= K175), P177 (≠ I198), N179 (= N200)
- binding uridine-5'-diphosphate: R147 (= R168), G189 (≠ D210), A190 (≠ G211), M194 (≠ F217), Y205 (≠ T228), I206 (= I229), F207 (≠ Y230), R214 (= R237), I251 (= I273)
4m55E Crystal structure of human udp-xylose synthase r236h substitution (see paper)
36% identity, 68% coverage: 30:265/348 of query aligns to 1:156/164 of 4m55E
- active site: T105 (= T142)
- binding nicotinamide-adenine-dinucleotide: G6 (= G35), G9 (= G38), F10 (= F39), V11 (≠ L40), D30 (= D59), N31 (= N60), F32 (= F61), T34 (= T63), G35 (= G64), D55 (= D84), V56 (= V85), S72 (≠ C101), P73 (= P102), T81 (= T118), T105 (= T142), T131 (= T201)
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
31% identity, 88% coverage: 30:336/348 of query aligns to 2:313/321 of 6zllA
- active site: T126 (= T142), S127 (= S143), S128 (≠ E144), Y149 (= Y171), K153 (= K175)
- binding nicotinamide-adenine-dinucleotide: G7 (= G35), G10 (= G38), F11 (= F39), I12 (≠ L40), D32 (= D59), H33 (≠ N60), F34 (= F61), I35 (vs. gap), K43 (≠ L65), D62 (= D84), I63 (≠ V85), L81 (= L99), A82 (= A100), A83 (≠ C101), I124 (≠ A140), T126 (= T142), Y149 (= Y171), K153 (= K175), Y176 (≠ I198), V179 (≠ T201), R185 (= R207), M188 (≠ R212)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (= P102), V87 (≠ S104), R88 (≠ P105), T126 (= T142), S127 (= S143), Y149 (= Y171), T178 (≠ N200), R185 (= R207), A189 (≠ V213), R192 (≠ N216), T204 (= T228), F206 (≠ Y230), Q211 (= Q235), R213 (= R237), I250 (= I273), E276 (≠ D299)
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
31% identity, 88% coverage: 30:336/348 of query aligns to 2:313/314 of 6zldA
- active site: T126 (= T142), S127 (= S143), S128 (≠ E144), Y149 (= Y171), K153 (= K175)
- binding nicotinamide-adenine-dinucleotide: G7 (= G35), G10 (= G38), F11 (= F39), I12 (≠ L40), D32 (= D59), H33 (≠ N60), F34 (= F61), I35 (vs. gap), K43 (≠ L65), D62 (= D84), I63 (≠ V85), L81 (= L99), A82 (= A100), A83 (≠ C101), I124 (≠ A140), T126 (= T142), K153 (= K175), Y176 (≠ I198), T178 (≠ N200), R185 (= R207), M188 (≠ R212)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (= P102), R88 (≠ P105), T126 (= T142), S127 (= S143), S128 (≠ E144), Y149 (= Y171), F177 (= F199), T178 (≠ N200), R185 (= R207), M188 (≠ R212), A189 (≠ V213), R192 (≠ N216), T204 (= T228), F206 (≠ Y230), Q211 (= Q235), R213 (= R237), I250 (= I273), E276 (≠ D299)
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
31% identity, 88% coverage: 30:336/348 of query aligns to 2:313/314 of 6zl6A
- active site: T126 (= T142), S127 (= S143), S128 (≠ E144), Y149 (= Y171), K153 (= K175)
- binding nicotinamide-adenine-dinucleotide: G7 (= G35), G10 (= G38), F11 (= F39), I12 (≠ L40), D32 (= D59), H33 (≠ N60), F34 (= F61), I35 (vs. gap), K43 (≠ L65), D62 (= D84), I63 (≠ V85), L81 (= L99), A82 (= A100), A83 (≠ C101), I124 (≠ A140), T126 (= T142), K153 (= K175), Y176 (≠ I198), T178 (≠ N200), V179 (≠ T201), R185 (= R207), M188 (≠ R212)
- binding uridine-5'-diphosphate: T178 (≠ N200), A189 (≠ V213), R192 (≠ N216), T204 (= T228), F206 (≠ Y230), Q211 (= Q235), R213 (= R237), I250 (= I273), E276 (≠ D299)
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
30% identity, 88% coverage: 30:336/348 of query aligns to 2:313/314 of 6zljA
- active site: T126 (= T142), S127 (= S143), S128 (≠ E144), F149 (= F165), K153 (= K175)
- binding nicotinamide-adenine-dinucleotide: G7 (= G35), G10 (= G38), F11 (= F39), I12 (≠ L40), D32 (= D59), H33 (≠ N60), F34 (= F61), I35 (vs. gap), K43 (≠ L65), D62 (= D84), I63 (≠ V85), L81 (= L99), A82 (= A100), A83 (≠ C101), I124 (≠ A140), T126 (= T142), K153 (= K175), Y176 (≠ I198), T178 (≠ N200), V179 (≠ T201), R185 (= R207), M188 (≠ R212)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (= P102), R88 (≠ P105), T126 (= T142), S127 (= S143), S128 (≠ E144), F149 (= F165), F177 (= F199), T178 (≠ N200), R185 (= R207), M188 (≠ R212), A189 (≠ V213), R192 (≠ N216), T204 (= T228), F206 (≠ Y230), Q211 (= Q235), R213 (= R237), I250 (= I273), E276 (≠ D299)
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
30% identity, 87% coverage: 30:333/348 of query aligns to 2:311/322 of 1r66A
- active site: T127 (= T142), D128 (≠ S143), E129 (= E144), Y151 (= Y171), K155 (= K175)
- binding nicotinamide-adenine-dinucleotide: G10 (= G38), F11 (= F39), I12 (≠ L40), D37 (= D59), S38 (≠ N60), L39 (≠ F61), T40 (≠ S62), G43 (= G64), D63 (= D84), I64 (≠ V85), F83 (≠ L99), A84 (= A100), A85 (≠ C101), S87 (≠ A103), T102 (= T118), V125 (≠ A140), S126 (= S141), Y151 (= Y171), K155 (= K175), N181 (≠ T201)
- binding thymidine-5'-diphosphate: H88 (≠ S104), E129 (= E144), N180 (= N200), K190 (≠ R212), L191 (≠ V213), P206 (≠ T228), Y208 (= Y230), R215 (= R237), N250 (≠ I273), R274 (≠ P300), H277 (≠ R303)
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
30% identity, 87% coverage: 30:333/348 of query aligns to 2:311/322 of 1r6dA
- active site: T127 (= T142), N128 (≠ S143), Q129 (≠ E144), Y151 (= Y171), K155 (= K175)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (≠ A103), H88 (≠ S104), T127 (= T142), N128 (≠ S143), Q129 (≠ E144), Y151 (= Y171), N180 (= N200), K190 (≠ R212), L191 (≠ V213), P206 (≠ T228), Y208 (= Y230), R215 (= R237), N250 (≠ I273), R274 (≠ P300), H277 (≠ R303), Y281 (≠ I307)
- binding nicotinamide-adenine-dinucleotide: G10 (= G38), F11 (= F39), I12 (≠ L40), D37 (= D59), S38 (≠ N60), L39 (≠ F61), T40 (≠ S62), A42 (≠ T63), G43 (= G64), D63 (= D84), I64 (≠ V85), F83 (≠ L99), A84 (= A100), A85 (≠ C101), S87 (≠ A103), T102 (= T118), V125 (≠ A140), S126 (= S141), Y151 (= Y171), K155 (= K175), N181 (≠ T201)
3ruhA Alternative analogs as viable substrates of udp-hexose 4-epimerases
30% identity, 88% coverage: 29:333/348 of query aligns to 17:331/336 of 3ruhA
- active site: S142 (≠ T142), S143 (= S143), S144 (≠ E144), Y166 (= Y171), K170 (= K175), N204 (≠ D209)
- binding nicotinamide-adenine-dinucleotide: G23 (= G35), G26 (= G38), F27 (= F39), I28 (≠ L40), D47 (= D59), N48 (= N60), S50 (= S62), T51 (= T63), G52 (= G64), D78 (= D84), I79 (≠ V85), Q98 (≠ L99), A99 (= A100), A100 (≠ C101), T117 (= T118), A140 (= A140), A141 (≠ S141), S142 (≠ T142), Y166 (= Y171), K170 (= K175), Y193 (≠ I198), V196 (≠ T201)
- binding [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl][(2R,3R,4R,5R,6R)-6-(hydroxymethyl)-4,5-bis(oxidanyl)-3-(2-oxidanylidenepropyl)oxan-2-yl] hydrogen phosphate: G102 (≠ A103), S103 (= S104), S142 (≠ T142), S143 (= S143), S144 (≠ E144), Y166 (= Y171), Y193 (≠ I198), N195 (= N200), A209 (vs. gap), V210 (= V213), K213 (≠ N216), W214 (≠ F217), Y225 (≠ T228), I226 (= I229), N227 (≠ Y230), R234 (= R237), L271 (≠ I273), R294 (≠ P296), D297 (= D299), V298 (≠ P300), S301 (≠ R303)
3rufA Alternative analogs as viable substrates of udp-hexose 4-epimerases
30% identity, 88% coverage: 29:333/348 of query aligns to 17:331/336 of 3rufA
- active site: S142 (≠ T142), S143 (= S143), S144 (≠ E144), Y166 (= Y171), K170 (= K175), N204 (≠ D209)
- binding nicotinamide-adenine-dinucleotide: G23 (= G35), G26 (= G38), F27 (= F39), I28 (≠ L40), D47 (= D59), N48 (= N60), S50 (= S62), T51 (= T63), G52 (= G64), D78 (= D84), I79 (≠ V85), Q98 (≠ L99), A99 (= A100), A100 (≠ C101), T117 (= T118), A140 (= A140), Y166 (= Y171), K170 (= K175), Y193 (≠ I198), V196 (≠ T201)
- binding uridine-5'-diphosphate: N195 (= N200), A209 (vs. gap), V210 (= V213), K213 (≠ N216), W214 (≠ F217), Y225 (≠ T228), I226 (= I229), N227 (≠ Y230), R234 (= R237), L271 (≠ I273), R294 (≠ P296), D297 (= D299)
3lu1A Crystal structure analysis of wbgu: a udp-galnac 4-epimerase (see paper)
30% identity, 88% coverage: 29:333/348 of query aligns to 17:331/336 of 3lu1A
- active site: S142 (≠ T142), S143 (= S143), S144 (≠ E144), Y166 (= Y171), K170 (= K175), N204 (≠ D209)
- binding glycine: Q135 (≠ R136), K187 (≠ E192)
- binding nicotinamide-adenine-dinucleotide: G23 (= G35), G26 (= G38), F27 (= F39), I28 (≠ L40), D47 (= D59), N48 (= N60), S50 (= S62), T51 (= T63), G52 (= G64), D78 (= D84), I79 (≠ V85), Q98 (≠ L99), A99 (= A100), A100 (≠ C101), A140 (= A140), A141 (≠ S141), S142 (≠ T142), Y166 (= Y171), K170 (= K175), Y193 (≠ I198), N195 (= N200)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (= S104), S142 (≠ T142), S143 (= S143), S144 (≠ E144), Y166 (= Y171), N195 (= N200), V210 (= V213), W214 (≠ F217), Y225 (≠ T228), I226 (= I229), N227 (≠ Y230), R234 (= R237), L271 (≠ I273), R294 (≠ P296), D297 (= D299)
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
31% identity, 87% coverage: 29:331/348 of query aligns to 2:306/308 of 6wj9B
- active site: A119 (≠ T142), A120 (≠ S143), A121 (≠ E144), F144 (≠ Y171), K148 (= K175)
- binding nicotinamide-adenine-dinucleotide: G8 (= G35), G11 (= G38), F12 (= F39), I13 (≠ L40), D32 (= D59), D33 (≠ N60), S35 (= S62), T36 (= T63), G37 (= G64), D55 (≠ F78), A56 (≠ R79), L75 (= L99), A76 (= A100), A77 (≠ C101), S94 (≠ T118), A117 (= A140), A119 (≠ T142), F144 (≠ Y171), K148 (= K175), F171 (≠ I198), F172 (= F199), I174 (≠ T201)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (≠ P105), N173 (= N200), G187 (≠ R212), V188 (= V213), F192 (= F217), T203 (= T228), L204 (≠ I229), F205 (≠ Y230), R212 (= R237), L248 (≠ I273), R271 (≠ P296), D274 (= D299)
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
31% identity, 87% coverage: 29:331/348 of query aligns to 1:305/307 of 6wjaA
- active site: A118 (≠ T142), A119 (≠ S143), A120 (≠ E144), F143 (≠ Y171), K147 (= K175)
- binding nicotinamide-adenine-dinucleotide: G7 (= G35), G10 (= G38), F11 (= F39), I12 (≠ L40), D31 (= D59), D32 (≠ N60), S34 (= S62), T35 (= T63), G36 (= G64), A55 (≠ R79), L74 (= L99), A75 (= A100), A76 (≠ C101), S93 (≠ T118), F143 (≠ Y171), K147 (= K175), F170 (≠ I198), F171 (= F199), I173 (≠ T201)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (≠ P105), A120 (≠ E144), N172 (= N200), G186 (≠ R212), V187 (= V213), F191 (= F217), T202 (= T228), F204 (≠ Y230), R211 (= R237), L247 (≠ I273), R270 (≠ P296), D273 (= D299)
6h0pA The structure of c100a mutant of arabidopsis thaliana udp-apiose/udp- xylose synthase in complex with nadh and udp-d-glucuronic acid (see paper)
30% identity, 87% coverage: 31:332/348 of query aligns to 13:363/375 of 6h0pA
- binding nicotinamide-adenine-dinucleotide: G17 (= G35), G20 (= G38), F21 (= F39), I22 (≠ L40), D42 (= D59), N69 (vs. gap), I70 (= I81), L89 (= L99), A90 (= A100), A91 (≠ C101), A93 (= A103), F130 (≠ A140), Y178 (= Y171), K182 (= K175)
- binding uridine-5'-diphosphate-glucuronic acid: P95 (= P105), Y98 (= Y108), T132 (= T142), E134 (= E144), R175 (= R168), Y178 (= Y171), N207 (= N200), R228 (= R212), V229 (= V213), C232 (≠ N216), F233 (= F217), V246 (≠ Y230), R253 (= R237), V291 (≠ I273), F323 (vs. gap), Y324 (vs. gap), Y328 (vs. gap), D330 (= D299), R334 (= R303)
Query Sequence
>SM_b20458 FitnessBrowser__Smeli:SM_b20458
MNYFRNDFRGTLFGTNEATDSLRRRSLQKRILVTGGAGFLGSHLCELLLGAGHEVICLDN
FSTGLRRNIAPLKRFDTFRVIAHDVVEPIDLEVDEIYNLACPASPPHYQADPIQTTKTCV
IGSLNLLDLAARRGARIFQASTSEIYGDPHVHPQVESYWGNVNPFGPRSCYDEGKRCAET
LFFDFHKSHGVEIKIVRIFNTYGPRMRPDDGRVVSNFIVQALKGEDITIYGDGSQTRSFC
FVEDLIDGFVRLMASPPSLTGPVNLGNPAEFTIGELAEEVIRLTGSRSKIVRRPLPVDDP
RQRRPDISLATEELGWRPKVNLAEGLAHTIRYFDDLLSRSMRESAELV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory