SitesBLAST
Comparing SM_b20481 FitnessBrowser__Smeli:SM_b20481 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
1ct9A Crystal structure of asparagine synthetase b from escherichia coli (see paper)
28% identity, 92% coverage: 23:563/591 of query aligns to 23:484/497 of 1ct9A
- active site: L50 (= L50), N74 (= N75), G75 (= G76), T305 (vs. gap), R308 (vs. gap), E332 (≠ Q371), M366 (≠ L452)
- binding adenosine monophosphate: L232 (= L266), L233 (= L267), S234 (= S268), S239 (= S273), A255 (≠ S292), V256 (= V293), D263 (≠ G300), M316 (≠ L356), S330 (= S369), G331 (= G370), E332 (≠ Q371)
- binding glutamine: R49 (= R49), L50 (= L50), I52 (= I52), V53 (≠ L53), N74 (= N75), G75 (= G76), E76 (≠ C77), D98 (= D100)
Sites not aligning to the query:
P22106 Asparagine synthetase B [glutamine-hydrolyzing]; AS-B; EC 6.3.5.4 from Escherichia coli (strain K12) (see 2 papers)
28% identity, 95% coverage: 1:563/591 of query aligns to 1:504/554 of P22106
- M1 (= M1) modified: Initiator methionine, Removed
- C2 (= C2) mutation C->A,S: Loss of glutamine-dependent activity but no effect on ammonia-dependent asparagine synthetase activity.
- H30 (≠ P29) mutation to A: 4,5-fold decrease in glutamine affinity.
- D34 (= D33) mutation D->N,E: Little effect on the kinetic properties.
- H81 (≠ F81) mutation to A: 5-fold decrease in glutamine affinity.
- A105 (≠ K106) mutation to H: Little effect on the kinetic properties.
- E349 (≠ Q371) mutation E->A,Q: Loss of glutamine- and ammonia-dependent synthetase activity, but still exhibits glutaminase activity.; mutation to D: 5-fold increase in affinity for aspartate when assaying both the glutamine- and ammonia-dependent synthetase reactions, and 2-fold decrease in kcat for these reactions. Modifies the product glutamate/asparagine stoichiometry.
P78753 Probable asparagine synthetase [glutamine-hydrolyzing]; Glutamine-dependent asparagine synthetase; EC 6.3.5.4 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 88% coverage: 23:540/591 of query aligns to 24:483/557 of P78753
- S391 (≠ V453) modified: Phosphoserine
Sites not aligning to the query:
- 489 modified: Phosphoserine
P08243 Asparagine synthetase [glutamine-hydrolyzing]; Cell cycle control protein TS11; Glutamine-dependent asparagine synthetase; EC 6.3.5.4 from Homo sapiens (Human) (see 7 papers)
26% identity, 88% coverage: 1:521/591 of query aligns to 1:470/561 of P08243
- C2 (= C2) active site, For GATase activity; mutation to A: Loss of the glutamine-dependent asparagine synthetase activity, while the ammonia-dependent activity remained unaffected.
- A6 (≠ G6) to E: in ASNSD; dramatic reduction in protein abundance; dbSNP:rs398122975
- V210 (≠ P191) to E: in dbSNP:rs1049674
- F362 (≠ D395) to V: in ASNSD; dramatic reduction in protein abundance; dbSNP:rs398122973
Sites not aligning to the query:
- 550 R → C: in ASNSD; increases level of protein abundance; dbSNP:rs398122974
6gq3A Human asparagine synthetase (asns) in complex with 6-diazo-5-oxo-l- norleucine (don) at 1.85 a resolution (see paper)
27% identity, 64% coverage: 5:383/591 of query aligns to 1:364/509 of 6gq3A
- active site: W4 (≠ V8), L49 (= L50), N74 (= N75), G75 (= G76), T324 (vs. gap), R327 (vs. gap)
- binding 5-oxo-l-norleucine: C1 (= C5), R48 (= R49), V51 (≠ I52), V52 (≠ L53), Y73 (≠ F74), N74 (= N75), G75 (= G76), E76 (≠ C77), V95 (≠ G99), D96 (= D100)
1mc1A Beta-lactam synthetase with product (dgpc), amp and ppi (see paper)
27% identity, 53% coverage: 71:381/591 of query aligns to 61:342/491 of 1mc1A
- active site: A65 (≠ N75), G66 (= G76), D306 (= D349), Y332 (≠ Q371)
- binding adenosine monophosphate: V231 (≠ L266), S233 (= S268), S238 (= S273), S256 (= S292), M257 (≠ V293), G331 (= G370)
- binding magnesium ion: D237 (= D272), D335 (= D374)
- binding deoxyguanidinoproclavaminic acid: Y310 (≠ F353), Y332 (≠ Q371), G333 (= G372), I336 (≠ E375)
- binding pyrophosphate 2-: S233 (= S268), G235 (= G270), D237 (= D272), S238 (= S273), D335 (= D374)
Sites not aligning to the query:
1mbzA Beta-lactam synthetase with trapped intermediate (see paper)
28% identity, 53% coverage: 71:381/591 of query aligns to 65:347/496 of 1mbzA
- active site: A69 (≠ N75), G70 (= G76), D311 (= D349), Y337 (≠ Q371)
- binding arginine-n-methylcarbonyl phosphoric acid 5'-adenosine ester: V236 (≠ L266), L237 (= L267), S238 (= S268), S243 (= S273), S261 (= S292), M262 (≠ V293), Y315 (≠ F353), L319 (vs. gap), G336 (= G370), Y337 (≠ Q371), G338 (= G372), D340 (= D374), I341 (≠ E375)
- binding magnesium ion: D242 (= D272), D340 (= D374)
- binding pyrophosphate 2-: S238 (= S268), G240 (= G270), D242 (= D272), S243 (= S273), D340 (= D374)
Sites not aligning to the query:
1jgtB Crystal structure of beta-lactam synthetase (see paper)
27% identity, 53% coverage: 71:381/591 of query aligns to 69:355/500 of 1jgtB
- active site: A73 (≠ N75), G74 (= G76), D319 (= D349), Y345 (≠ Q371)
- binding diphosphomethylphosphonic acid adenosyl ester: V244 (≠ L266), L245 (= L267), S246 (= S268), G248 (= G270), I249 (≠ V271), D250 (= D272), S251 (= S273), S269 (= S292), M270 (≠ V293), L327 (vs. gap), G344 (= G370), Y345 (≠ Q371), D348 (= D374)
- binding n2-(carboxyethyl)-l-arginine: Y323 (≠ F353), Y345 (≠ Q371), G346 (= G372), D348 (= D374), I349 (≠ E375), M354 (≠ Y380)
- binding magnesium ion: D250 (= D272), D348 (= D374)
Sites not aligning to the query:
1mb9A Beta-lactam synthetase complexed with atp (see paper)
27% identity, 53% coverage: 71:381/591 of query aligns to 66:346/485 of 1mb9A
- active site: A70 (≠ N75), G71 (= G76), D310 (= D349), Y336 (≠ Q371)
- binding adenosine monophosphate: V235 (≠ L266), L236 (= L267), S242 (= S273), S260 (= S292), M261 (≠ V293), Y314 (≠ F353), L318 (vs. gap), G335 (= G370), Y336 (≠ Q371)
- binding adenosine-5'-triphosphate: V235 (≠ L266), L236 (= L267), S237 (= S268), G239 (= G270), D241 (= D272), S242 (= S273), S260 (= S292), M261 (≠ V293), L318 (vs. gap), G335 (= G370), D339 (= D374)
- binding magnesium ion: D241 (= D272), D339 (= D374)
- binding pyrophosphate 2-: S237 (= S268), G239 (= G270), D241 (= D272), S242 (= S273), D339 (= D374)
Sites not aligning to the query:
Q9XB61 Carbapenam-3-carboxylate synthase; Carbapenam-3-carboxylate ligase; EC 6.3.3.6 from Pectobacterium carotovorum subsp. carotovorum (Erwinia carotovora subsp. carotovora) (see 3 papers)
22% identity, 48% coverage: 96:379/591 of query aligns to 77:353/503 of Q9XB61
- 244:251 (vs. 266:273, 75% identical) binding
- I270 (≠ V293) binding
- GYGSD 344:348 (≠ GQGAD 370:374) binding
- Y345 (≠ Q371) mutation to A: Loss of activity.; mutation to F: Reduces catalytic efficiency.
- G346 (= G372) binding
Sites not aligning to the query:
- 371 binding
- 374 binding
- 380 E→A: Loss of activity.; E→D: Reduces catalytic efficiency.; E→Q: Reduces catalytic efficiency.
- 421 binding
- 443 mutation K->A,M: Loss of activity.
- 444:446 binding
1q19A Carbapenam synthetase (see paper)
22% identity, 48% coverage: 96:379/591 of query aligns to 76:352/500 of 1q19A
- active site: L318 (≠ M345), E321 (≠ Y348), Y344 (≠ Q371)
- binding diphosphomethylphosphonic acid adenosyl ester: P243 (≠ L266), L244 (= L267), S245 (= S268), D249 (= D272), S250 (= S273), S268 (= S292), I269 (≠ V293), T342 (≠ S369), G343 (= G370), D347 (= D374)
- binding (2s,5s)-5-carboxymethylproline: Y344 (≠ Q371), G345 (= G372), L348 (≠ E375)
Sites not aligning to the query:
Q9STG9 Amidophosphoribosyltransferase 2, chloroplastic; AtATase2; AtPURF2; PRPP2; Glutamine phosphoribosylpyrophosphate amidotransferase 2; AtGPRAT2; Protein CHLOROPLAST IMPORT APPARATUS 1; Protein DIFFERENTIAL DEVELOPMENT OF VASCULAR ASSOCIATED CELLS; EC 2.4.2.14 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
28% identity, 25% coverage: 16:165/591 of query aligns to 130:285/561 of Q9STG9
- H187 (≠ F74) mutation to T: In cia1-2; small plants with white leaves showing an irregular mosaic of green sectors.
- R264 (≠ K145) mutation to K: Strong resistance to the bleaching herbicides DAS073 and DAS734.
- P265 (= P146) mutation to S: Low resistance to the bleaching herbicides DAS073 and DAS734; when associated with F-494.
Sites not aligning to the query:
- 371 G→S: Low resistance to the bleaching herbicides DAS073 and DAS734.
- 476 P→S: Resistance to the bleaching herbicides DAS073 and DAS734.
- 494 Y→F: Low resistance to the bleaching herbicides DAS073 and DAS734; when associated with S-265.
6lbpA Structure of the glutamine phosphoribosylpyrophosphate amidotransferase from arabidopsis thaliana (see paper)
28% identity, 25% coverage: 16:165/591 of query aligns to 44:199/460 of 6lbpA
Sites not aligning to the query:
- active site: 1, 27, 243, 301, 306, 316, 424
- binding iron/sulfur cluster: 237, 239, 383, 385, 434, 436, 437
Query Sequence
>SM_b20481 FitnessBrowser__Smeli:SM_b20481
MCGICGEVRFDGGSPSVTAVSIMADVLAPRGPDASGVVVRGNVGLGHRRLRILDLSDKSQ
QPMVDSDLGLSLVFNGCIYNFRELRLELEEKGYRFFSSGDTEVILKAWHAWGEECVSRFH
GMFAFVIHERDSGRVVMARDRFGIKPLYIAEVQGALRFASALPALVKAGGVDTSIDVAAL
HNYMTFHAVVPPPRTILNGVRKLPPATLRVYERDGSFEDRRYWDPPYRRQAGDAAISREE
WQEQLLDALRIAVKRRMVADVPVGVLLSGGVDSSLIVGLLAEAGQRGLMSFSVGFEEANG
EKGDEFVYSDLIAGHFGTDHRKIFVPSADLMGALPGTIAAMSEPMVSYDNVGFYLLSKEV
SKHVKVVQSGQGADEVFGGYHWYPPLMNSNDVVADYGKAFRDRSHAVLTTQLSDAWIADH
DVSGDLLNEHLLREGAATPVDQALRLDSNVMLVDDPVKRVDNMTMAWGLEARVPFLDHEL
VELAARMPPEEKLRDGGKGILKDVARRVIPSEVIDRKKGYFPVPQLKYIAGPYLDLIRDT
LRSQKARERGLFQDAYLDRLFQEPSDHITPLRGSELWQVGLLEMWLEAQGV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory