Comparing SM_b20484 FitnessBrowser__Smeli:SM_b20484 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4pz0A The crystal structure of a solute binding protein from bacillus anthracis str. Ames in complex with quorum-sensing signal autoinducer-2 (ai-2)
28% identity, 84% coverage: 26:301/330 of query aligns to 6:284/321 of 4pz0A
4wzzA Crystal structure of an abc transporter solute binding protein (ipr025997) from clostridium phytofermentas (cphy_0583, target efi- 511148) with bound l-rhamnose
26% identity, 78% coverage: 27:285/330 of query aligns to 4:266/321 of 4wzzA
1tjyA Crystal structure of salmonella typhimurium ai-2 receptor lsrb in complex with r-thmf (see paper)
24% identity, 84% coverage: 29:305/330 of query aligns to 5:285/316 of 1tjyA
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
27% identity, 72% coverage: 40:278/330 of query aligns to 13:248/305 of 3c6qC
Sites not aligning to the query:
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
27% identity, 83% coverage: 30:303/330 of query aligns to 9:282/289 of 5hqjA
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
27% identity, 72% coverage: 40:278/330 of query aligns to 13:248/313 of 2h3hA
Sites not aligning to the query:
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
28% identity, 78% coverage: 30:288/330 of query aligns to 3:257/274 of 2ioyA
3ejwA Crystal structure of the sinorhizobium meliloti ai-2 receptor, smlsrb (see paper)
27% identity, 83% coverage: 29:301/330 of query aligns to 3:278/315 of 3ejwA
3t95A Crystal structure of lsrb from yersinia pestis complexed with autoinducer-2 (see paper)
23% identity, 83% coverage: 29:301/330 of query aligns to 3:277/314 of 3t95A
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
28% identity, 79% coverage: 28:289/330 of query aligns to 1:265/290 of 4wutA
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
25% identity, 66% coverage: 26:244/330 of query aligns to 1:224/287 of 5dteB
Sites not aligning to the query:
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
23% identity, 79% coverage: 30:289/330 of query aligns to 4:258/271 of 1dbpA
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
22% identity, 83% coverage: 29:303/330 of query aligns to 10:277/284 of 7e7mC
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
25% identity, 79% coverage: 29:290/330 of query aligns to 4:270/297 of 4ry9B
4ry9A Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
25% identity, 79% coverage: 29:290/330 of query aligns to 4:270/297 of 4ry9A
6dspA Lsrb from clostridium saccharobutylicum in complex with ai-2 (see paper)
22% identity, 81% coverage: 30:295/330 of query aligns to 3:279/326 of 6dspA
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
23% identity, 73% coverage: 32:272/330 of query aligns to 6:253/288 of 8wlbA
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
23% identity, 73% coverage: 32:272/330 of query aligns to 6:253/288 of 8wl9A
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
23% identity, 73% coverage: 32:272/330 of query aligns to 6:253/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
23% identity, 73% coverage: 32:272/330 of query aligns to 6:253/288 of 1gudA
Sites not aligning to the query:
>SM_b20484 FitnessBrowser__Smeli:SM_b20484
MIKKILAAALAASLSLAGAYTAAAQDTGKVGVVVKIGGIPWFNAMEAGIKERGEKLGVDA
FMVGPTSADPALQVRAIEDLIAQNVKVIGVVPNDAKVLEPVLTKAREKGIIVITHESPSQ
KGADWDFELASATGFGEAHAKLLAEKMGGKGEYAVFVGSLTVPLHNAWADAAIEYIKKNH
PEMTLVGDRYGVAEDVDKSRSTALDLISAHPDLKGFLAFGSQGPIGAGRAIEERRKVGEI
FVLGPFSPGQGQKLIKSDAISGGFMWNPKQAGEVFVTLAAKLMKGEEIKDGEEIEGLGVI
HPDFENRNIIVDQLVPINKETVADLAAMGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory