Comparing SM_b20497 FitnessBrowser__Smeli:SM_b20497 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
29% identity, 95% coverage: 4:488/509 of query aligns to 4:477/478 of 5ya2A
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
30% identity, 95% coverage: 4:488/509 of query aligns to 4:477/478 of 5ya1A
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
28% identity, 98% coverage: 6:502/509 of query aligns to 3:484/484 of P09099
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
28% identity, 98% coverage: 6:502/509 of query aligns to 3:476/476 of 2itmA
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
23% identity, 97% coverage: 4:498/509 of query aligns to 3:490/490 of 3ll3B
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
23% identity, 97% coverage: 4:498/509 of query aligns to 4:492/492 of 3ll3A
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
24% identity, 95% coverage: 1:484/509 of query aligns to 1:483/496 of P18157
3kzbA Crystal structure of xylulokinase from chromobacterium violaceum
27% identity, 83% coverage: 4:427/509 of query aligns to 5:431/498 of 3kzbA
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
27% identity, 91% coverage: 5:469/509 of query aligns to 1:457/485 of 6k76A
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
25% identity, 89% coverage: 4:454/509 of query aligns to 6:459/501 of O34154
Sites not aligning to the query:
3h3nX Glycerol kinase h232r with glycerol (see paper)
25% identity, 93% coverage: 3:473/509 of query aligns to 4:477/501 of 3h3nX
O34153 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus casseliflavus (Enterococcus flavescens) (see 3 papers)
25% identity, 93% coverage: 3:473/509 of query aligns to 5:478/506 of O34153
3l0qA The crystal structure of xlylulose kinase from yersinia pseudotuberculosis
23% identity, 95% coverage: 4:486/509 of query aligns to 3:529/541 of 3l0qA
6udeB Crystal structure of glycerol kinase from elizabethkingia anophelis nuhp1 in complex with adp and glycerol
25% identity, 92% coverage: 5:470/509 of query aligns to 5:470/495 of 6udeB
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
25% identity, 95% coverage: 1:484/509 of query aligns to 1:483/498 of Q5HGD2
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
25% identity, 95% coverage: 1:484/509 of query aligns to 2:484/499 of 3ge1A
O86033 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
25% identity, 92% coverage: 1:469/509 of query aligns to 1:473/497 of O86033
1bu6Y Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
23% identity, 94% coverage: 4:484/509 of query aligns to 4:486/499 of 1bu6Y
P0A6F3 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Escherichia coli (strain K12) (see 10 papers)
23% identity, 94% coverage: 4:484/509 of query aligns to 6:488/502 of P0A6F3
Sites not aligning to the query:
1glfO Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
23% identity, 94% coverage: 4:484/509 of query aligns to 4:486/498 of 1glfO
>SM_b20497 FitnessBrowser__Smeli:SM_b20497
MGDYLLGLDAGNTVIKAVIFDRKGKEIASAAAEGHSRMPYPGHVERDLDELWENARRVIR
KCIDEAGIDAGELAAIGCAGHGNGLYALDHEGRPLLGIQSLDTRAAALVEEWTSQGVGDR
TYPIGQQRPWPSQTPTLLAWMKRYRPEVFASIGTIFLCKDFIVNRLTGARVSDVSDMTGC
GLLNVAGRHYDRELMAAYGLCESMDLLPPLVESAEIAGRITEAAAAGTGLAAGTPVVGGL
FDVVASAIGSGVTRTGAASIIAGTWSINQVIIERPELQGPVFMSSTFDRDRYMAIESSAT
SAANLEWLVREFFSEVRSDGRSPFDLCCELASSSDPAFDDPIYHPYLYGAQQDGSARAGF
YGIAGWHTKGHLVRAVLEGVAFGHRQHIETMRKAGAAFDEAVLSGGGSRSLIWPQIFADV
IGVPVSVAGSRETGALGAAIAAATGVGIFSDFAEGAAAMVKTERHYLPNRALEAHYARRY
ALYRDIADVMTPLWRRLSAMQAITAGVAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory