SitesBLAST
Comparing SM_b20500 FitnessBrowser__Smeli:SM_b20500 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
46% identity, 87% coverage: 10:298/331 of query aligns to 6:286/331 of P80874
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
45% identity, 87% coverage: 10:298/331 of query aligns to 6:286/333 of 1pz1A
- active site: D52 (= D56), Y57 (= Y61), K90 (≠ H92), Q93 (= Q95), H125 (= H138)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G23), W21 (= W25), Q175 (= Q188), Y203 (= Y216), G204 (≠ S217), L206 (= L219), R208 (≠ L221), K214 (≠ S227), G280 (= G292), R282 (= R294), Q286 (= Q298)
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
41% identity, 96% coverage: 10:327/331 of query aligns to 6:321/326 of P77256
- D232 (≠ E231) mutation D->A,E: Converts the protein into an enzyme with dual specificity, i.e. that is able to use both NADPH and NADH as cosubstrates.
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
36% identity, 95% coverage: 9:323/331 of query aligns to 5:310/310 of P46336
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
36% identity, 95% coverage: 9:323/331 of query aligns to 4:309/311 of 1pz0A
- active site: D52 (= D56), Y57 (= Y61), N91 (= N97), H124 (= H138)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: H124 (= H138), Q174 (= Q188), Y202 (= Y216), F203 (≠ S217), P204 (≠ S218), L205 (= L219), S207 (≠ L221), G208 (= G222), A211 (≠ S225), K213 (≠ S227)
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
35% identity, 95% coverage: 7:322/331 of query aligns to 3:292/301 of 6ow0B
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G23), L21 (≠ W25), Y50 (= Y61), H117 (= H138), S147 (= S168), Y200 (= Y216), F201 (≠ S217), L203 (= L219), Q205 (≠ L221), T209 (≠ S225), Q268 (= Q298), N272 (= N302)
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
34% identity, 95% coverage: 7:322/331 of query aligns to 3:316/323 of 6ow0A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G28), L21 (≠ W30), D49 (= D56), Y54 (= Y61), S151 (= S168), Y204 (= Y216), F205 (≠ S217), L207 (= L219), Q209 (≠ L221), G210 (= G222), T213 (≠ S225), K215 (≠ S227), R227 (= R240), V284 (≠ L290), G286 (= G292), Q292 (= Q298), N296 (= N302)
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
33% identity, 95% coverage: 6:320/331 of query aligns to 3:273/275 of 6kiyA
- binding {5-[(2E)-2-methyl-3-phenylprop-2-en-1-ylidene]-4-oxo-2-thioxo-1,3-thiazolidin-3-yl}acetic acid: W22 (= W25), Y59 (= Y61), W87 (= W91), H118 (= H138), R204 (≠ L221)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G23), T21 (= T24), W22 (= W25), Y59 (= Y61), H118 (= H138), N149 (= N169), Q170 (= Q188), Y199 (= Y216), S200 (= S217), P201 (≠ S218), L202 (= L219), R204 (≠ L221), T205 (≠ G222), Y227 (≠ A273), I243 (≠ L290), P244 (≠ C291), K245 (≠ G292), G247 (≠ R294), R248 (≠ N295), H251 (≠ Q298), E254 (≠ D301), N255 (= N302)
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
33% identity, 95% coverage: 6:320/331 of query aligns to 3:273/275 of 6kikA
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
33% identity, 95% coverage: 6:320/331 of query aligns to 2:272/274 of 5danA
- active site: D53 (= D56), Y58 (= Y61), K84 (= K86), H117 (= H138)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G23), T20 (= T24), W21 (= W25), D53 (= D56), Y58 (= Y61), H117 (= H138), Q169 (= Q188), Y198 (= Y216), S199 (= S217), P200 (≠ S218), L201 (= L219), R203 (≠ L221), Y226 (≠ A273), I242 (≠ L290), P243 (≠ C291), K244 (≠ G292), G246 (≠ R294), R247 (≠ N295), H250 (≠ Q298), E253 (≠ D301), N254 (= N302)
4wghA Crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with NADP and acetate at 1.8 a resolution
32% identity, 92% coverage: 16:319/331 of query aligns to 12:268/283 of 4wghA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G23), T20 (= T24), W21 (= W25), D49 (= D56), Y54 (= Y61), N142 (= N169), Q164 (= Q188), Y192 (= Y216), C193 (≠ S217), P194 (≠ S218), L195 (= L219), Q197 (≠ S227), A198 (≠ I228), R200 (≠ P230), A223 (= A273), I239 (≠ L290), P240 (≠ C291), K241 (≠ G292), A242 (= A293), A243 (≠ R294), S244 (≠ N295), H247 (≠ Q298), N251 (= N302)
6ciaA Crystal structure of aldo-keto reductase from klebsiella pneumoniae in complex with NADPH.
32% identity, 92% coverage: 16:319/331 of query aligns to 13:269/284 of 6ciaA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G23), T21 (= T24), W22 (= W25), D50 (= D56), Y55 (= Y61), H113 (= H138), N143 (= N169), Q165 (= Q188), Y193 (= Y216), C194 (≠ S217), P195 (≠ S218), L196 (= L219), Q198 (≠ S227), A199 (≠ I228), A224 (= A273), I240 (≠ L290), P241 (≠ C291), K242 (≠ G292), A243 (= A293), A244 (≠ R294), S245 (≠ N295), H248 (≠ Q298), N252 (= N302)
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
29% identity, 95% coverage: 9:322/331 of query aligns to 5:309/337 of Q3L181
- D52 (= D56) mutation to A: 99% loss of activity.
- Y57 (= Y61) mutation to A: 99% loss of activity.
- K84 (= K86) mutation to A: Total loss of activity.
- H126 (= H138) mutation to A: 98% loss of activity.
Q9P7U2 Putative aryl-alcohol dehydrogenase C977.14c; EC 1.1.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
31% identity, 94% coverage: 10:319/331 of query aligns to 12:339/351 of Q9P7U2
- S113 (≠ Q94) modified: Phosphoserine
8hw0A The structure of akr6d1
29% identity, 98% coverage: 8:331/331 of query aligns to 4:328/329 of 8hw0A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G23), W21 (= W25), Q27 (≠ M31), D49 (= D56), Y54 (= Y61), R123 (≠ W139), S152 (= S168), Q178 (= Q188), W207 (≠ Y216), S208 (= S217), P209 (≠ S218), L210 (= L219), S212 (≠ L221), K218 (≠ R232), S227 (≠ Q239), R228 (= R240), I285 (≠ L290), G287 (= G292), S289 (≠ R294), Q293 (= Q298), D296 (= D301), N297 (= N302)
5c7hA Crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 in complex with NADPH
32% identity, 92% coverage: 14:319/331 of query aligns to 13:266/281 of 5c7hA
- active site: D52 (= D56), Y57 (= Y61), K82 (= K86), H115 (= H138)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G23), T23 (= T24), W24 (= W25), D52 (= D56), Y57 (= Y61), H115 (= H138), Q167 (= Q188), Y195 (= Y216), S196 (= S217), P197 (≠ S218), L198 (= L219), E200 (≠ L221), L204 (≠ T255), A221 (= A273), I237 (≠ L290), P238 (≠ C291), K239 (≠ G292), T240 (≠ A293), R245 (≠ Q298), E248 (≠ D301), N249 (= N302)
Sites not aligning to the query:
4pmjA Crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021 in complex with NADP
32% identity, 92% coverage: 14:319/331 of query aligns to 13:266/281 of 4pmjA
- active site: D52 (= D56), Y57 (= Y61), K82 (= K86), H115 (= H138)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G22 (= G23), T23 (= T24), W24 (= W25), D52 (= D56), H115 (= H138), Q167 (= Q188), Y195 (= Y216), S196 (= S217), P197 (≠ S218), L198 (= L219), E200 (≠ L221), L204 (≠ T255), A221 (= A273), I237 (≠ L290), P238 (≠ C291), K239 (≠ G292), T240 (≠ A293), G241 (≠ R294), R245 (≠ Q298), E248 (≠ D301), N249 (= N302)
5t79A X-ray crystal structure of a novel aldo-keto reductases for the biocatalytic conversion of 3-hydroxybutanal to 1,3-butanediol (see paper)
31% identity, 95% coverage: 8:322/331 of query aligns to 16:313/315 of 5t79A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G31 (= G23), W33 (= W25), Y66 (= Y61), H138 (= H138), N169 (= N169), Q193 (= Q188), F221 (≠ Y216), S222 (= S217), L224 (= L219), G226 (≠ L221), T230 (≠ S225), R232 (≠ S227), S263 (≠ A273), L280 (= L290), G282 (= G292), S284 (≠ R294), Q288 (= Q298)
3eauA Voltage-dependent k+ channel beta subunit in complex with cortisone (see paper)
29% identity, 96% coverage: 5:322/331 of query aligns to 3:321/327 of 3eauA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G21 (= G23), W23 (= W25), Q29 (≠ G34), D51 (= D56), Y56 (= Y61), K84 (= K86), S154 (= S168), Q180 (= Q188), W209 (≠ Y216), S210 (= S217), P211 (≠ S218), L212 (= L219), A213 (= A220), C214 (≠ L221), G215 (= G222), K220 (≠ S227), R230 (= R232), L287 (= L290), L288 (≠ C291), G289 (= G292), S291 (≠ R294), Q295 (= Q298), E298 (≠ D301), N299 (= N302)
- binding 17,21-dihydroxypregna-1,4-diene-3,11,20-trione: W23 (= W25), V55 (≠ A60), Y56 (= Y61), W87 (≠ D101), N124 (≠ H138), R155 (≠ N169), I174 (= I187), I177 (vs. gap), I202 (≠ N209)
1exbA Structure of the cytoplasmic beta subunit-t1 assembly of voltage- dependent k channels (see paper)
29% identity, 96% coverage: 5:322/331 of query aligns to 2:320/326 of 1exbA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G23), W22 (= W25), Q28 (≠ G34), D50 (= D56), Y55 (= Y61), S153 (= S168), R154 (≠ N169), Q179 (= Q188), W208 (≠ Y216), S209 (= S217), P210 (≠ S218), L211 (= L219), C213 (≠ L221), G214 (= G222), S217 (= S225), K219 (≠ S227), S228 (≠ E231), R229 (= R232), L286 (= L290), G288 (= G292), S290 (≠ R294), Q294 (= Q298), E297 (≠ D301), N298 (= N302)
Query Sequence
>SM_b20500 FitnessBrowser__Smeli:SM_b20500
MNGQQIMREIGRSGVAASAVGLGTWAIGGWMWGGTDERESVAAIQASLDAGVTLIDTAPA
YGLGRAEEIVGKALSGRRDKAVIATKCGLVWHTQQGNHFFDQDGRPVHRHLGRESIFHEV
EQSLRRLGTDYIDLYITHWQDPTTPIEETMRALEDLRAAGKIRAIGASNVNLEELQIYVQ
IGGLDAIQERFSMLDREIEAQLLPVTMANGVATLSYSSLALGLLSGSIGPERVFSGDDQR
RNNPRFSVANREKVTRFAEAIRPIAQEYEGSIAQIVIAWTLAQPGITFALCGARNPAQAL
DNAGAGTIRLSAEALSAIDAAIAAELANMDR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory