Comparing SM_b20503 FitnessBrowser__Smeli:SM_b20503 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
42% identity, 96% coverage: 4:496/512 of query aligns to 2:493/501 of P04983
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 46% coverage: 6:240/512 of query aligns to 4:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 46% coverage: 6:241/512 of query aligns to 4:254/254 of 1g6hA
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
26% identity, 46% coverage: 1:236/512 of query aligns to 1:233/240 of 1ji0A
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 43% coverage: 6:224/512 of query aligns to 2:217/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 44% coverage: 9:234/512 of query aligns to 4:223/240 of 4ymuJ
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 46% coverage: 9:246/512 of query aligns to 6:244/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 46% coverage: 9:246/512 of query aligns to 6:244/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 46% coverage: 9:246/512 of query aligns to 6:244/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
30% identity, 46% coverage: 9:246/512 of query aligns to 6:244/353 of Q97UY8
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
31% identity, 43% coverage: 259:476/512 of query aligns to 1:222/253 of 7z15I
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
31% identity, 43% coverage: 259:476/512 of query aligns to 1:222/250 of 7z18I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
31% identity, 43% coverage: 259:476/512 of query aligns to 1:222/250 of 7z16I
3c4jA Abc protein artp in complex with atp-gamma-s
26% identity, 43% coverage: 6:224/512 of query aligns to 3:219/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
26% identity, 43% coverage: 6:224/512 of query aligns to 3:219/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
26% identity, 43% coverage: 6:224/512 of query aligns to 3:219/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
26% identity, 43% coverage: 6:224/512 of query aligns to 3:219/242 of 2oljA
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
28% identity, 47% coverage: 4:243/512 of query aligns to 2:231/285 of 4yerA
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
30% identity, 44% coverage: 259:485/512 of query aligns to 2:228/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
30% identity, 44% coverage: 259:485/512 of query aligns to 2:228/263 of 7d08B
>SM_b20503 FitnessBrowser__Smeli:SM_b20503
MTSETVLEIRNVSKHFGAVKALTAVDFRLARGEVHALCGENGAGKSTLMNVIAGVLQPSE
GEVLIEGAPVKIASPAVAQSLGIALVHQEIALCPDATIAENMFMAATNRRRSALMNYAQL
ERDAQAVMNRLAPIDVSQKVGDLPISSQQLVEIAKALTLDCRVLIFDEPTAALTETEAQV
LFGIIRDLKARGISIIYISHRMAEVFSLCDRVTVFRDGRYVATEMVSDVTPDDVVRLMVG
REISQLYPDKQPSSERLGEPILSVRDLGGERFRDVSFELRYGEILGVGGLIGSGRTEIAE
GICALRPVTQGEIRLHDKVLRLRRYSDAAKAGVVYLSEDRKGSGVFLDLSIAQNIAALDL
KALTSLGLLNSREERALAEDLTRRLGVRMGGVDMPVSSLSGGNQQKVAIAKQLAVDPKVI
LMDEPTRGIDVGAKSEIHRLLRELARAGIGILVISSELPELIGLCDRVLVVREGRIAGEV
SGNEMTEEVIMRLASGIGPATETNLKASGHAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory