SitesBLAST
Comparing SM_b20507 FitnessBrowser__Smeli:SM_b20507 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
42% identity, 97% coverage: 1:493/508 of query aligns to 1:492/501 of P04983
- K43 (= K43) mutation to R: Loss of transport.
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
34% identity, 42% coverage: 7:220/508 of query aligns to 14:228/265 of P07821
- K50 (= K43) mutation to Q: Lack of activity.
- D172 (= D165) mutation to E: Lack of activity.
- E173 (= E166) mutation to A: Lack of activity.
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
34% identity, 45% coverage: 4:231/508 of query aligns to 5:233/233 of P75957
- G42 (= G37) mutation to D: Loss of lipoprotein release when overexpressed.
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 43% coverage: 3:220/508 of query aligns to 3:230/254 of 1g6hA
7mdyC Lolcde nucleotide-bound
34% identity, 43% coverage: 4:220/508 of query aligns to 2:222/226 of 7mdyC
- binding adp orthovanadate: Y12 (= Y14), G42 (= G40), S43 (≠ A41), G44 (= G42), K45 (= K43), S46 (= S44), T47 (= T45), Q91 (= Q86), H138 (≠ A136), E142 (≠ S140), S144 (= S142), G145 (≠ I143), G146 (= G144), E168 (= E166), N172 (≠ S170), H201 (= H198)
- binding magnesium ion: S46 (= S44), Q91 (= Q86)
7arlD Lolcde in complex with lipoprotein and adp (see paper)
34% identity, 43% coverage: 4:220/508 of query aligns to 2:222/222 of 7arlD
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 43% coverage: 3:220/508 of query aligns to 3:230/253 of 1g9xB
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
33% identity, 43% coverage: 4:220/508 of query aligns to 4:224/229 of 7v8iD
- binding phosphoaminophosphonic acid-adenylate ester: V23 (vs. gap), S43 (≠ N39), G44 (= G40), G46 (= G42), K47 (= K43), S48 (= S44), T49 (= T45), Q93 (= Q86), R137 (≠ D133), H140 (≠ A136), E144 (≠ S140), S146 (= S142), G148 (= G144), E149 (= E145), H203 (= H198)
- binding magnesium ion: S48 (= S44), Q93 (= Q86)
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
28% identity, 49% coverage: 1:249/508 of query aligns to 1:248/648 of P75831
- K47 (= K43) mutation to L: Lack of activity.
- D169 (= D165) mutation to N: Lack of activity.
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
28% identity, 42% coverage: 5:218/508 of query aligns to 7:217/240 of 1ji0A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 41% coverage: 12:218/508 of query aligns to 13:219/343 of P30750
- 40:46 (vs. 39:45, 86% identical) binding
- E166 (= E166) mutation to Q: Exhibits little ATPase activity.
Sites not aligning to the query:
- 278:283 binding
- 295 N→A: Reduces the binding of L-methionine to undetectable levels.
- 295:296 binding
7nezA Structure of topotecan-bound abcg2 (see paper)
30% identity, 43% coverage: 5:223/508 of query aligns to 3:221/563 of 7nezA
Sites not aligning to the query:
6vxhA Structure of abcg2 bound to imatinib (see paper)
30% identity, 43% coverage: 5:223/508 of query aligns to 3:221/565 of 6vxhA
Sites not aligning to the query:
Q9UNQ0 Broad substrate specificity ATP-binding cassette transporter ABCG2; ATP-binding cassette sub-family G member 2; Breast cancer resistance protein; CDw338; Mitoxantrone resistance-associated protein; Placenta-specific ATP-binding cassette transporter; Urate exporter; CD338 antigen; EC 7.6.2.2 from Homo sapiens (Human) (see 20 papers)
31% identity, 39% coverage: 27:223/508 of query aligns to 70:269/655 of Q9UNQ0
- M71 (≠ R28) mutation to V: Decreased protein abundance. No effect on substrate transmembrane transport.
- 80:87 (vs. 37:44, 63% identical) binding
- K86 (= K43) mutation to M: Decreased protein abundance. Decreased localization to the plasma membrane and retained intracellularly. Loss of ATPase-coupled transmembrane transporter activity.
- Q141 (≠ W101) to K: associated with high serum levels of uric acid and increased risk of gout; results in lower urate transport rates compared to wild-type; decreased protein abundance; dbSNP:rs2231142
- R147 (≠ G107) to W: loss of protein expression; loss of localization to the plasma membrane; dbSNP:rs372192400
- T153 (≠ D113) to M: decreased protein abundance; no effect on localization to the plasma membrane; no effect on substrate transmembrane transport; decreased ATPase activity; no effect on ATPase-coupled transmembrane transporter activity; dbSNP:rs753759474
- R160 (≠ V120) to Q: in dbSNP:rs528655917
- Q166 (≠ A126) to E: in dbSNP:rs1061017
- 184:190 (vs. 141:145, 43% identical) binding
- I206 (≠ V161) to L: in dbSNP:rs12721643
- F208 (≠ A163) to S: in dbSNP:rs1061018
- E211 (= E166) binding ; mutation to Q: Decreased estrone-3 sulfate ATPase-coupled transmembrane transporter activity. Decreased substrate-induced ATP hydrolysis. Decreased substrate transport.
- H243 (= H198) binding
Sites not aligning to the query:
- 12 V → M: found in Jr(a-) blood group phenotype; dbSNP:rs2231137
- 13 S → L: in dbSNP:rs1319203095
- 296 D → H: in dbSNP:rs41282401
- 316 natural variant: T -> P
- 354 G → R: in dbSNP:rs138606116
- 360 natural variant: Missing (no effect on protein abundance; no effect on localization to the plasma membrane; no effect on ATPase activity; no effect on substrate transmembrane transport)
- 362 modified: Phosphothreonine; by PIM1; T→A: Loss of phosphorylation by PIM1. Decreased localization to the plasma membrane. Decreased homooligomerization. Loss of function in resistance to drug treatment.; T→D: Loss of phosphorylation by PIM1. Constitutive drug resistance independent of PIM1.
- 373 F → C: decreased protein abundance; decreased localization to the plasma membrane; no effect on ATPase-coupled transmembrane transporter activity; dbSNP:rs752626614
- 383 R→C: Loss of protein expression.
- 418 Not glycosylated; N→Q: No effect.
- 421 T → A: no effect on protein abundance; no effect on substrate transmembrane transport; dbSNP:rs199854112
- 431 natural variant: F -> L
- 434 T → M: no effect on protein abundance; no effect on localization to the plasma membrane; increased ATPase activity; decreased ATPase-coupled transmembrane transporter activity; dbSNP:rs769734146
- 435 T→A: No effect on stability. Increased estrone-3 sulfate ATPase-coupled transmembrane transporter activity. Increased substrate-induced ATP hydrolysis. Increased substrate transport.; T→F: No effect on stability. Decreased estrone-3 sulfate ATPase-coupled transmembrane transporter activity. Decreased substrate-induced ATP hydrolysis. Decreased substrate transport.
- 436 N→A: No effect on stability. Decreased estrone-3 sulfate ATPase-coupled transmembrane transporter activity. Decreased substrate-induced ATP hydrolysis. Decreased substrate transport.
- 439 F→A: No effect on stability. Decreased estrone-3 sulfate ATPase-coupled transmembrane transporter activity. Decreased substrate-induced ATP hydrolysis. Decreased substrate transport.
- 441 S → N: in dbSNP:rs1354553769
- 476 S → P: no effect on protein abundance; no effect on localization to the plasma membrane; no effect on ATPase activity; decreased ATPase-coupled transmembrane transporter activity; dbSNP:rs1274428653
- 482 R→D: Decreases ATPase activity.; mutation R->G,N,S,T: Increases ATPase activity.; mutation R->K,I,M,Y: No change in ATPase activity.; mutation R->T,Y: Decreases transport activity.
- 489 F → L: in dbSNP:rs192169063
- 528 A → T: in dbSNP:rs45605536
- 546 V→A: No effect on stability. No effect on estrone-3 sulfate ATPase-coupled transmembrane transporter activity. No effect on substrate-induced ATP hydrolysis. No effect on substrate transport.; V→F: No effect on stability. Decreased estrone-3 sulfate ATPase-coupled transmembrane transporter activity. Increased basal and substrate-induced ATP hydrolysis. Decreased substrate transport.
- 549 M→A: No effect on stability. No effect on estrone-3 sulfate ATPase-coupled transmembrane transporter activity. No effect on substrate-induced ATP hydrolysis. No effect on substrate transport.
- 554 L→A: No effect on stability. Increased estrone-3 sulfate ATPase-coupled transmembrane transporter activity. Increased basal and substrate-induced ATP hydrolysis. Increased substrate transport.
- 555 L→A: Loss of protein expression.
- 557 Not glycosylated; N→Q: No effect.
- 572 S → R: decreased protein abundance; loss of localization to the plasma membrane; dbSNP:rs200894058
- 583 H→A: Strongly reduced binding to hemin but not to PPIX.
- 590 N → Y: in dbSNP:rs34264773
- 592 modified: Disulfide link with 608
- 596 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Loss of glycosylation.
- 603 modified: Interchain; C→A: Strongly reduced binding to hemin but not to PPIX.
- 605 Y→A: No effect on hemin binding.
- 608 modified: Disulfide link with 592
- 620 D → N: no effect on protein abundance; no effect on substrate transmembrane transport; dbSNP:rs34783571
7neqA Structure of tariquidar-bound abcg2 (see paper)
30% identity, 43% coverage: 5:223/508 of query aligns to 3:221/566 of 7neqA
Sites not aligning to the query:
6vxjA Structure of abcg2 bound to sn38 (see paper)
30% identity, 43% coverage: 5:223/508 of query aligns to 3:221/566 of 6vxjA
Sites not aligning to the query:
6vxiA Structure of abcg2 bound to mitoxantrone (see paper)
30% identity, 43% coverage: 5:223/508 of query aligns to 3:221/566 of 6vxiA
Sites not aligning to the query:
6feqA Structure of inhibitor-bound abcg2 (see paper)
30% identity, 43% coverage: 5:223/508 of query aligns to 3:221/566 of 6feqA
Sites not aligning to the query:
6etiA Structure of inhibitor-bound abcg2 (see paper)
30% identity, 43% coverage: 5:223/508 of query aligns to 3:221/566 of 6etiA
Sites not aligning to the query:
- binding ~{tert}-butyl 3-[(2~{S},5~{S},8~{S})-14-cyclopentyloxy-2-(2-methylpropyl)-4,7-bis(oxidanylidene)-3,6,17-triazatetracyclo[8.7.0.0^{3,8}.0^{11,16}]heptadeca-1(10),11,13,15-tetraen-5-yl]propanoate: 309, 313, 351, 455, 458, 461
6hijA Cryo-em structure of the human abcg2-mz29-fab complex with cholesterol and pe lipids docked (see paper)
31% identity, 39% coverage: 27:223/508 of query aligns to 28:227/572 of 6hijA
Sites not aligning to the query:
- binding ~{tert}-butyl 3-[(2~{S},5~{S},8~{S})-14-cyclopentyloxy-2-(2-methylpropyl)-4,7-bis(oxidanylidene)-3,6,17-triazatetracyclo[8.7.0.0^{3,8}.0^{11,16}]heptadeca-1(10),11,13,15-tetraen-5-yl]propanoate: 315, 319, 323, 350, 353, 354, 357, 457, 461, 464, 467
- binding cholesterol: 299, 385, 389, 393, 402, 432, 465, 489, 494, 545, 557, 558, 563, 565
Query Sequence
>SM_b20507 FitnessBrowser__Smeli:SM_b20507
MQDFLEFQSISKGYPGVQALSEVSFSVRKGAVHGLMGENGAGKSTLIRVLSGDQAADTGE
IRINGEPQHYRSVRDAFNAGVIVIHQELQLVPELTVAENLWLGRFPGKAGVIDRRQLIRV
VSDRLAEIGIDVDPEAKVASLSIGERQMVEIAKAVMTDARVIALDEPTSSLSSRESEILF
ALIDRLRSNGTVILYVSHRLDEIFRLCNSLTVLRDGRLAAHHPDISKVGREQIIAEMVGR
EISNIWGWRARTLGAARLTVERVSGANLPQPISFTVRAGEILGFFGLIGAGRSEMARLVY
GADRRRQGKVLVDGLAVPADSPRLSIRAGVVLCPEDRKFDGIVQGRSIEENMAISSRRHF
SPFGVVDKGKEAELAERFIAKLRVRTPSRHQDIVNLSGGNQQKVILGRWLSEEGVKVLLI
DEPTRGIDVGAKSEIYEILYELAAQGMAIVVISSELPEVMGIADRILVMCEGRIAAEIDR
SDFDEHRILAAALPDASATTATLPEQVS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory