SitesBLAST
Comparing SM_b20511 FitnessBrowser__Smeli:SM_b20511 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
34% identity, 96% coverage: 4:252/259 of query aligns to 4:242/244 of 4nbuB
- active site: G18 (= G18), N111 (= N115), S139 (= S143), Q149 (≠ H152), Y152 (= Y156), K156 (= K160)
- binding acetoacetyl-coenzyme a: D93 (≠ F97), K98 (≠ E102), S139 (= S143), N146 (≠ I149), V147 (≠ I150), Q149 (≠ H152), Y152 (= Y156), F184 (≠ Y188), M189 (≠ K193), K200 (≠ P204)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), N17 (≠ Q17), G18 (= G18), I19 (= I19), D38 (= D38), F39 (≠ R39), V59 (≠ A63), D60 (= D64), V61 (≠ I65), N87 (= N91), A88 (= A92), G89 (= G93), I90 (≠ V94), T137 (≠ I141), S139 (= S143), Y152 (= Y156), K156 (= K160), P182 (= P186), F184 (≠ Y188), T185 (≠ V189), T187 (= T191), M189 (≠ K193)
2dtxA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with d-mannose (see paper)
34% identity, 97% coverage: 5:254/259 of query aligns to 5:247/255 of 2dtxA
2dteA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with nadh (see paper)
34% identity, 97% coverage: 5:254/259 of query aligns to 5:247/255 of 2dteA
- active site: G18 (= G18), S132 (= S143), Y145 (= Y156), S148 (≠ A159), K149 (= K160)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), S16 (≠ A16), M17 (≠ Q17), G18 (= G18), I19 (= I19), S38 (≠ D38), I39 (≠ R39), C52 (≠ A63), D53 (= D64), V54 (≠ I65), N80 (= N91), A81 (= A92), I130 (= I141), S132 (= S143), Y145 (= Y156), K149 (= K160), P174 (= P186), A175 (≠ G187), T176 (≠ Y188), I177 (≠ V189), T179 (vs. gap), P180 (vs. gap), L181 (= L190), V182 (≠ T191)
4fn4A Short-chain NAD(h)-dependent dehydrogenase/reductase from sulfolobus acidocaldarius (see paper)
33% identity, 97% coverage: 5:255/259 of query aligns to 5:254/254 of 4fn4A
- active site: G18 (= G18), S144 (= S143), Y157 (= Y156), K161 (= K160), S202 (≠ D203)
- binding nicotinamide-adenine-dinucleotide: G14 (= G14), S17 (≠ Q17), G18 (= G18), I19 (= I19), E38 (≠ D38), L39 (≠ R39), R43 (≠ L43), A63 (= A63), D64 (= D64), V65 (≠ I65), N91 (= N91), G93 (= G93), I94 (≠ V94), T142 (≠ I141), S144 (= S143), Y157 (= Y156), K161 (= K160), P187 (= P186), V190 (= V189), T192 (= T191), N193 (≠ Q192), I194 (≠ Y195)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
35% identity, 97% coverage: 5:255/259 of query aligns to 3:251/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G16 (= G18), I17 (= I19), D36 (= D38), L37 (≠ R39), C61 (≠ A63), D62 (= D64), V63 (≠ I65), N89 (= N91), A90 (= A92), T140 (≠ I141), S142 (= S143), Y155 (= Y156), K159 (= K160), A186 (≠ G187), V187 (≠ Y188)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
31% identity, 97% coverage: 5:255/259 of query aligns to 3:248/248 of 6ixmC
- active site: G16 (= G18), S142 (= S143), Y155 (= Y156), K159 (= K160)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), S15 (≠ Q17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (≠ R39), A61 (= A63), D62 (= D64), T63 (≠ I65), N89 (= N91), A90 (= A92), M140 (≠ I141), S142 (= S143), Y155 (= Y156), K159 (= K160), P185 (= P186), A186 (≠ G187), Y187 (= Y188), I188 (≠ V189), L192 (≠ K193)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
33% identity, 98% coverage: 1:253/259 of query aligns to 4:251/258 of 4wecA
- active site: G21 (= G18), S143 (= S143), Q154 (≠ T153), Y157 (= Y156), K161 (= K160)
- binding nicotinamide-adenine-dinucleotide: G17 (= G14), A19 (= A16), S20 (≠ Q17), G21 (= G18), I22 (= I19), D41 (= D38), I42 (≠ R39), V61 (≠ A63), D62 (= D64), V63 (≠ I65), N89 (= N91), T141 (≠ I141), Y157 (= Y156), K161 (= K160), P187 (= P186), P189 (≠ Y188), V190 (= V189)
A7IQH5 2-(S)-hydroxypropyl-CoM dehydrogenase 3; S-HPCDH 3; 2-[(S)-2-hydroxypropylthio]ethanesulfonate dehydrogenase 3; Aliphatic epoxide carboxylation component IV; Epoxide carboxylase component IV; SHPCDH3; EC 1.1.1.269 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 2 papers)
36% identity, 98% coverage: 1:255/259 of query aligns to 1:255/255 of A7IQH5
- I19 (= I19) binding
- D38 (= D38) binding
- DV 64:65 (≠ DI 64:65) binding
- N91 (= N91) binding
- S143 (= S143) binding ; mutation to A: Retains very weak activity.
- Y156 (= Y156) binding ; mutation to A: Retains some activity but with more than 2200-fold decrease in catalytic efficiency.; mutation to F: Loss of activity.
- K160 (= K160) binding ; mutation to A: Loss of activity.
- T188 (≠ Y188) binding
- VTSTG 189:193 (≠ VL-TQ 189:192) binding
- R211 (≠ T211) mutation to A: Severely impaired in the oxidation of S-HPC or reduction of 2-KPC but largely unaffected in the oxidation and reduction of aliphatic alcohols and ketones.
- K214 (≠ L214) mutation to A: Severely impaired in the oxidation of S-HPC or reduction of 2-KPC but largely unaffected in the oxidation and reduction of aliphatic alcohols and ketones.
- Y215 (≠ H215) binding
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
31% identity, 95% coverage: 5:251/259 of query aligns to 3:244/248 of 4urfB
- active site: G16 (= G18), S142 (= S143), I152 (≠ T153), Y155 (= Y156), K159 (= K160)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ G217), R211 (≠ G218), R212 (= R219)
- binding bicarbonate ion: I92 (≠ V94), G94 (vs. gap), R109 (= R110), R179 (= R180), S228 (= S235)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G14 (≠ A16), N15 (≠ Q17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (≠ R39), D62 (= D64), T63 (≠ I65), N89 (= N91), A90 (= A92), G91 (= G93), I140 (= I141), Y155 (= Y156), K159 (= K160), P185 (= P186), A186 (≠ G187), I188 (≠ V189), T190 (= T191)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
31% identity, 95% coverage: 5:251/259 of query aligns to 3:244/248 of 4urfA
- active site: G16 (= G18), S142 (= S143), I152 (≠ T153), Y155 (= Y156), K159 (= K160)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (≠ V94), S93 (≠ N95), G94 (vs. gap), E95 (≠ V96), T97 (≠ S98), E101 (= E102), T103 (≠ S104), Q106 (≠ D107), R109 (= R110), S175 (= S176), G177 (= G178)
- binding magnesium ion: S237 (≠ T244), Y238 (≠ C245)
- binding nicotinamide-adenine-dinucleotide: G12 (= G14), G14 (≠ A16), N15 (≠ Q17), G16 (= G18), I17 (= I19), D36 (= D38), I37 (≠ R39), W41 (≠ L43), D62 (= D64), T63 (≠ I65), N89 (= N91), A90 (= A92), G91 (= G93), I140 (= I141), Y155 (= Y156), K159 (= K160), P185 (= P186), I188 (≠ V189), T190 (= T191)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
31% identity, 95% coverage: 5:251/259 of query aligns to 3:244/248 of 4ureB
- active site: G16 (= G18), S142 (= S143), I152 (≠ T153), Y155 (= Y156), K159 (= K160)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ Q17), G16 (= G18), I17 (= I19), N89 (= N91), G91 (= G93), Y155 (= Y156), P185 (= P186), A186 (≠ G187)
4ituA Crystal structure of s-2-hydroxypropyl coenzyme m dehydrogenase (s- hpcdh) bound to s-hpc and nadh (see paper)
34% identity, 89% coverage: 25:255/259 of query aligns to 23:253/253 of 4ituA
- active site: N113 (= N115), S141 (= S143), Y154 (= Y156), K158 (= K160)
- binding 2-{[(2S)-2-hydroxypropyl]sulfanyl}ethanesulfonic acid: S141 (= S143), Y154 (= Y156), T186 (≠ Y188), R209 (≠ T211), Y213 (≠ H215)
- binding 1,4-dihydronicotinamide adenine dinucleotide: D36 (= D38), L37 (≠ R39), D62 (= D64), V63 (≠ I65), N89 (= N91), V112 (≠ I114), F139 (≠ I141), S141 (= S143), Y154 (= Y156), K158 (= K160), P184 (= P186), T186 (≠ Y188), V187 (= V189), T190 (= T191), M192 (≠ K193)
Sites not aligning to the query:
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
32% identity, 97% coverage: 4:253/259 of query aligns to 13:258/261 of 5u9pB
- active site: G27 (= G18), S152 (= S143), Y165 (= Y156), K169 (= K160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G14), R26 (≠ Q17), G27 (= G18), I28 (= I19), R48 (= R39), D73 (= D64), V74 (≠ I65), N100 (= N91), A101 (= A92), I150 (= I141), Y165 (= Y156), K169 (= K160), P195 (= P186), F198 (≠ V189), T200 (= T191), L202 (≠ K193), N203 (≠ A194)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
29% identity, 97% coverage: 4:253/259 of query aligns to 4:253/255 of 5itvA
- active site: G18 (= G18), S141 (= S143), Y154 (= Y156), K158 (= K160)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), S17 (≠ Q17), G18 (= G18), I19 (= I19), D38 (= D38), I39 (≠ R39), T61 (≠ A63), I63 (= I65), N89 (= N91), G91 (= G93), T139 (≠ I141), S141 (= S143), Y154 (= Y156), K158 (= K160), P184 (= P186), G185 (= G187), I186 (≠ Y188), I187 (≠ V189)
4gh5A Crystal structure of s-2-hydroxypropyl coenzyme m dehydrogenase (s- hpcdh) (see paper)
33% identity, 89% coverage: 25:255/259 of query aligns to 23:248/248 of 4gh5A
- active site: N113 (= N115), S141 (= S143), Y154 (= Y156), K158 (= K160)
- binding nicotinamide-adenine-dinucleotide: D36 (= D38), L37 (≠ R39), A61 (= A63), D62 (= D64), V63 (≠ I65), N89 (= N91), A90 (= A92), V112 (≠ I114), F139 (≠ I141), S141 (= S143), Y154 (= Y156), K158 (= K160), P184 (= P186), V187 (= V189), T190 (≠ Q192), G191 (≠ K193), M192 (≠ A194)
Sites not aligning to the query:
5ojiA Crystal structure of the dehydrogenase/reductase sdr family member 4 (dhrs4) from caenorhabditis elegans (see paper)
31% identity, 97% coverage: 4:253/259 of query aligns to 7:257/260 of 5ojiA
- active site: G21 (= G18), S148 (= S143), Y161 (= Y156), K165 (= K160)
- binding isatin: S148 (= S143), S150 (≠ H145), Y161 (= Y156), V193 (≠ Y188), S199 (≠ A194), L202 (≠ Y197)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A17 (≠ G14), T19 (≠ A16), I22 (= I19), S41 (≠ D38), R42 (= R39), N43 (≠ D40), N46 (≠ L43), I69 (= I65), N95 (= N91), H96 (≠ A92), G97 (= G93), N146 (≠ I141), S148 (= S143), Y161 (= Y156), K165 (= K160), G192 (= G187), I194 (≠ V189), T196 (= T191), M198 (≠ K193)
5ojgA Crystal structure of the dehydrogenase/reductase sdr family member 4 (dhrs4) from caenorhabditis elegans (see paper)
31% identity, 97% coverage: 4:253/259 of query aligns to 7:257/260 of 5ojgA
- active site: G21 (= G18), S148 (= S143), Y161 (= Y156), K165 (= K160)
- binding butane-2,3-dione: S148 (= S143), Y161 (= Y156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A17 (≠ G14), T19 (≠ A16), G21 (= G18), I22 (= I19), S41 (≠ D38), R42 (= R39), N43 (≠ D40), N46 (≠ L43), I69 (= I65), N95 (= N91), H96 (≠ A92), G97 (= G93), N146 (≠ I141), S148 (= S143), Y161 (= Y156), K165 (= K160), P191 (= P186), I194 (≠ V189), T196 (= T191), M198 (≠ K193)
1iy8A Crystal structure of levodione reductase (see paper)
31% identity, 98% coverage: 4:256/259 of query aligns to 1:258/258 of 1iy8A
- active site: G15 (= G18), S143 (= S143), Q153 (≠ T153), Y156 (= Y156), K160 (= K160)
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), S14 (≠ Q17), G15 (= G18), L16 (≠ I19), D35 (= D38), V36 (≠ R39), A62 (= A63), D63 (= D64), V64 (≠ I65), N90 (= N91), G92 (= G93), I93 (≠ V94), T141 (≠ I141), S143 (= S143), Y156 (= Y156), K160 (= K160), P186 (= P186), G187 (= G187), T191 (= T191), P192 (≠ Q192), M193 (≠ K193)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
33% identity, 96% coverage: 4:252/259 of query aligns to 5:245/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G14), R18 (≠ Q17), G19 (= G18), I20 (= I19), D39 (= D38), R40 (= R39), C63 (≠ A63), I65 (= I65), N91 (= N91), G93 (= G93), I94 (≠ V94), V114 (≠ I114), Y155 (= Y156), K159 (= K160), I188 (≠ V189), T190 (= T191), T193 (≠ W198)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
30% identity, 98% coverage: 2:256/259 of query aligns to 8:267/267 of Q9LBG2
- 17:42 (vs. 11:36, 38% identical) binding
- E103 (≠ N95) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
Query Sequence
>SM_b20511 FitnessBrowser__Smeli:SM_b20511
MSDRLKGKRIMVTGAAQGIGLAIAEAFLSERAALFLLDRDGPLLEKEAKRLQRQGQSLAY
AEADITDAEAIESTLSAAASSIGPINALVNNAGVNVFSEPLEMSNADWQRCFDINLRGAW
NCCKAVLPSLIEQGGGAILNIASTHAFTIIPHTFPYPVAKHALIGMTKALGIEYASKGVR
VNALAPGYVLTQKAYDYWNSFPDPAAAEAATLKLHPGGRIATAEEIARAAVFMISDECPF
MNATCLTVDGGLSVLHHPA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory