SitesBLAST
Comparing SM_b20575 FitnessBrowser__Smeli:SM_b20575 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
A0A0K2JL82 Nitrosuccinate lyase; EC 4.3.99.5 from Streptomyces cremeus (see paper)
36% identity, 90% coverage: 30:345/351 of query aligns to 42:374/476 of A0A0K2JL82
- N93 (≠ V81) mutation to A: Slight decrease in activity.
- D125 (= D110) mutation D->N,V: Almost loss of activity.
- R137 (≠ A122) binding
- R140 (≠ E125) binding
- R201 (≠ T187) binding
- H253 (= H228) mutation to A: Loss of activity.
- S302 (= S273) mutation to A: Loss of activity.
- K308 (= K279) binding ; mutation to A: Loss of activity.
- N310 (= N281) binding ; mutation to A: Loss of activity.
- R341 (= R312) mutation to A: Loss of activity.
5xnzA Crystal structure of cred complex with fumarate (see paper)
35% identity, 90% coverage: 30:345/351 of query aligns to 28:343/439 of 5xnzA
P12047 Adenylosuccinate lyase; ASL; Adenylosuccinase; ASase; Glutamyl--tRNA ligase regulatory factor; EC 4.3.2.2 from Bacillus subtilis (strain 168) (see paper)
25% identity, 97% coverage: 6:345/351 of query aligns to 5:334/431 of P12047
- H89 (= H103) mutation to Q: Abolishes enzyme activity.
- H141 (≠ R155) mutation to Q: Abolishes enzyme activity.
- Q212 (≠ W227) mutation to E: Decreases catalytic activity 1000-fold.; mutation to M: Abolishes enzyme activity.
- N270 (= N281) mutation N->D,L: Abolishes enzyme activity.
- R301 (= R312) mutation R->K,Q: Abolishes enzyme activity.
2x75A Staphylococcus aureus adenylosuccinate lyase (see paper)
24% identity, 87% coverage: 32:335/351 of query aligns to 21:323/427 of 2x75A
Sites not aligning to the query:
4efcA Crystal structure of adenylosuccinate lyase from trypanosoma brucei, tb427tmp.160.5560
27% identity, 62% coverage: 68:286/351 of query aligns to 86:312/452 of 4efcA
- active site: H96 (≠ I78), T173 (= T154), H174 (≠ R155), S300 (= S274), K305 (= K279), E312 (= E286)
- binding adenosine monophosphate: N95 (≠ A77), H96 (≠ I78), D97 (= D79), S127 (= S108), Q128 (= Q109), I309 (≠ V283)
- binding magnesium ion: D274 (≠ K250), D278 (= D254)
Sites not aligning to the query:
P30566 Adenylosuccinate lyase; ADSL; ASL; Adenylosuccinase; ASase; EC 4.3.2.2 from Homo sapiens (Human) (see 13 papers)
29% identity, 58% coverage: 97:299/351 of query aligns to 101:315/484 of P30566
- Y114 (≠ D110) to H: in ADSLD; severe; total loss of activity; dbSNP:rs374259530
- R141 (≠ A137) to W: in ADSLD; severe; dbSNP:rs756210458
- H159 (≠ R155) active site, Proton donor/acceptor
- R190 (= R181) to Q: in ADSLD; moderate; dbSNP:rs28941471
- R194 (vs. gap) to C: in ADSLD; severe; reduces protein stability; dbSNP:rs1465152683
- K246 (≠ R231) to E: in ADSLD; moderate; strongly reduced catalytic activity; dbSNP:rs119450944
- D268 (= D254) to N: in ADSLD; severe; total loss of activity; dbSNP:rs746501563
- S289 (= S273) active site, Proton donor/acceptor
- R303 (≠ V287) to C: in ADSLD; mild; strongly reduced activity with SAMP, but only slightly reduced activity with SAICAR; abolishes cooperativity; dbSNP:rs373458753
- L311 (≠ N295) to V: in ADSLD; severe; slightly reduced enzyme activity
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine; A → V: in ADSLD; severe; dbSNP:rs143083947
- 3 A → V: in ADSLD; severe
- 26 M → L: in ADSLD; severe; dbSNP:rs1311171245
- 72 I → V: in ADSLD; severe
- 100 P → A: in ADSLD; moderate; dbSNP:rs119450942
- 318 P → L: in ADSLD; severe; dbSNP:rs202064195
- 364 V → M: in ADSLD; severe; dbSNP:rs370851726
- 374 R → W: in ADSLD; severe; dbSNP:rs376533026
- 395 S → R: in ADSLD; severe
- 396 R → C: in ADSLD; severe; abolishes cooperativity and reduces enzyme activity; dbSNP:rs755492501; R → H: in ADSLD; severe; abolishes cooperativity and reduces enzyme activity; dbSNP:rs763542069
- 422 D → Y: in ADSLD; moderate; dbSNP:rs119450943
- 423 L → V: in ADSLD; moderate
- 426 R → H: in ADSLD; severe; most frequent mutation; dbSNP:rs119450941
- 430 D → N: in ADSLD; mild; dbSNP:rs554254383
- 438 S → P: in ADSLD; severe; dbSNP:rs119450940
- 447 S → P: in ADSLD; severe; dbSNP:rs777821034
- 450 T → S: in ADSLD; moderate; dbSNP:rs372895468
- 452 R → P: in ADSLD; severe
5nx9D Crystal structure of neanderthal adenylosuccinate lyase (adsl) in complex with its products amp and fumarate (see paper)
29% identity, 58% coverage: 97:299/351 of query aligns to 94:308/477 of 5nx9D
- active site: T151 (= T154), H152 (≠ R155), S283 (= S274), K288 (= K279), E295 (= E286)
- binding 2-[9-(3,4-dihydroxy-5-phosphonooxymethyl-tetrahydro-furan-2-yl)-9h-purin-6-ylamino]-succinic acid: T151 (= T154), H152 (≠ R155)
- binding adenosine monophosphate: S105 (= S108), Q234 (= Q226), R296 (≠ V287)
- binding fumaric acid: S105 (= S108), Q234 (= Q226), S282 (= S273), S283 (= S274), K288 (= K279)
Sites not aligning to the query:
Q9X0I0 Adenylosuccinate lyase; ASL; Adenylosuccinase; ASase; EC 4.3.2.2 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
22% identity, 91% coverage: 28:346/351 of query aligns to 18:335/431 of Q9X0I0
- H141 (≠ R155) active site, Proton donor/acceptor
Q05911 Adenylosuccinate lyase; ASL; Adenylosuccinase; ASase; EC 4.3.2.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
27% identity, 56% coverage: 98:293/351 of query aligns to 99:306/482 of Q05911
- K196 (≠ G195) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
5nxaB Crystal structure of neanderthal adenylosuccinate lyase (adsl)in complex with its products aicar and fumarate (see paper)
29% identity, 56% coverage: 104:299/351 of query aligns to 39:246/415 of 5nxaB
- active site: T89 (= T154), H90 (≠ R155), S221 (= S274), K226 (= K279), E233 (= E286)
- binding aminoimidazole 4-carboxamide ribonucleotide: M230 (≠ V283), R234 (≠ V287)
- binding fumaric acid: S220 (= S273), S221 (= S274), M223 (= M276), K226 (= K279), N228 (= N281)
- binding n-{[5-amino-1-(5-o-phosphono-beta-d-arabinofuranosyl)-1h-imidazol-4-yl]carbonyl}-l-aspartic acid: S43 (= S108), T89 (= T154), H90 (≠ R155), Q172 (= Q226)
Sites not aligning to the query:
4mx2B Crystal structure of adenylosuccinate lyase from leishmania donovani
31% identity, 31% coverage: 93:202/351 of query aligns to 110:217/439 of 4mx2B
Sites not aligning to the query:
- active site: 95, 302
- binding adenosine monophosphate: 17, 18, 94, 95, 96, 299, 303, 329, 331, 334, 335, 338
5vkwB Crystal structure of adenylosuccinate lyase ade13 from candida albicans
27% identity, 56% coverage: 98:293/351 of query aligns to 99:299/469 of 5vkwB
Sites not aligning to the query:
Query Sequence
>SM_b20575 FitnessBrowser__Smeli:SM_b20575
MTYSAFDHPYLSGLLGDEAVAAEFSVVADVRAMLAFEAALARAEARHGVIPEAAANRIAE
ACRGFSPDVGAMRRATAIDGVVVPELVRQLRRAVGEEAAEHVHFGATSQDVVDTSLMLRL
KAIAELFSGRVGDVVTALEACGRHWGERALTAHTRMQPAIAITVADRLRSWIEPLLDHQD
RLDTTGTDIFAVQFGGAAGTLEKLKGKADIVRATLAEELALVDCPQWHSQRLPIADFAHL
LSLVTGSLGKFGQDVALMAQAGDEIVLAGGGGSSAMPHKQNPVAAEVLVTLARFNATQVS
AIHQSLVHEQERSGSAWTLEWLILPQMVGATAAALRLAAELAGNVRRLGRV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory