SitesBLAST
Comparing SM_b20611 FitnessBrowser__Smeli:SM_b20611 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
31% identity, 92% coverage: 14:417/441 of query aligns to 11:421/425 of O59010
- S65 (≠ T66) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S277) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 277:279) binding
- M311 (≠ L312) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T315) binding
- V355 (≠ I356) binding
- D394 (≠ S390) binding
- M395 (≠ E391) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R393) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N397) binding
- D405 (≠ N401) mutation to N: Strongly decreased affinity for aspartate.
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
33% identity, 92% coverage: 15:419/441 of query aligns to 9:421/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
33% identity, 92% coverage: 15:419/441 of query aligns to 8:420/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ R197), G195 (≠ I201), R282 (≠ N288)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S277), S272 (= S278), S273 (= S279), M307 (≠ L312), T310 (= T315), G353 (= G358), A354 (= A359), R394 (= R393), T395 (≠ A394)
Sites not aligning to the query:
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
33% identity, 92% coverage: 15:419/441 of query aligns to 11:423/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
33% identity, 92% coverage: 15:419/441 of query aligns to 11:423/427 of 5e9sA
- binding aspartic acid: R274 (≠ S277), S275 (= S278), S276 (= S279), T313 (= T315), G353 (= G355), V354 (≠ I356), A357 (= A359), G358 (= G360), D394 (≠ S390), R397 (= R393), T398 (≠ A394)
- binding decyl-beta-d-maltopyranoside: L194 (≠ R197), G198 (≠ I201), Y202 (≠ A205)
- binding sodium ion: Y87 (≠ F91), T90 (≠ F94), S91 (= S95), S276 (= S279), G305 (= G307), A306 (≠ Y308), T307 (≠ S309), N309 (= N311), N309 (= N311), M310 (≠ L312), D311 (= D313), S348 (= S350), I349 (≠ K351), G350 (= G352), T351 (≠ A353), N401 (= N397), V402 (≠ F398), D405 (≠ N401)
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
32% identity, 92% coverage: 15:419/441 of query aligns to 4:412/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S277), S265 (= S279), M299 (≠ L312), T302 (= T315), T340 (≠ A353), G342 (= G355), V343 (≠ I356), G347 (= G360), D383 (≠ S390), R386 (= R393), T387 (≠ A394), N390 (= N397)
- binding decyl-beta-d-maltopyranoside: H23 (= H35), V212 (≠ I226), A216 (= A230)
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
31% identity, 92% coverage: 12:415/441 of query aligns to 9:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L47), F46 (≠ L47), P75 (≠ D76), L91 (≠ A93), F95 (≠ L97), L130 (≠ I139), I133 (≠ F142), I159 (≠ V168), Y167 (≠ I176), K196 (≠ R197), G200 (≠ I201), I207 (= I208), F210 (= F211), L250 (≠ V251), I262 (= I263), M269 (≠ L270), T334 (≠ S335), V335 (≠ Y336), G336 (= G337), T340 (≠ L341), L343 (= L344), M399 (≠ L395)
- binding aspartic acid: S277 (= S278), S278 (= S279), T314 (= T315), G354 (= G355), A358 (= A359), G359 (= G360), D394 (≠ S390), R397 (= R393), T398 (≠ A394)
- binding sodium ion: Y89 (≠ F91), T92 (≠ F94), S93 (= S95), G306 (= G307), T308 (≠ S309), N310 (= N311), N310 (= N311), M311 (≠ L312), D312 (= D313), S349 (= S350), I350 (≠ K351), T352 (≠ A353), N401 (= N397), V402 (≠ F398), D405 (≠ N401)
Sites not aligning to the query:
2nwwA Crystal structure of gltph in complex with tboa (see paper)
31% identity, 90% coverage: 14:412/441 of query aligns to 2:407/407 of 2nwwA
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
31% identity, 91% coverage: 14:413/441 of query aligns to 3:409/409 of 6bavA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
31% identity, 91% coverage: 12:412/441 of query aligns to 6:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G70), V83 (≠ M88), I157 (≠ L169), Y164 (≠ I176), K193 (≠ R197), T305 (≠ S309), I306 (≠ F310), I347 (≠ K351)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ L19), M199 (= M203), S275 (= S279), T311 (= T315), G356 (= G360), L384 (= L383), D391 (≠ S390), R394 (= R393)
Sites not aligning to the query:
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
31% identity, 90% coverage: 14:412/441 of query aligns to 3:408/408 of 6bauA
- binding cysteine: S270 (= S279), M303 (≠ L312), T306 (= T315), A345 (= A354), G346 (= G355), V347 (≠ I356), G351 (= G360), D386 (≠ S390), C389 (≠ R393), T390 (≠ A394), N393 (= N397)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
29% identity, 90% coverage: 14:412/441 of query aligns to 3:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
29% identity, 88% coverage: 30:419/441 of query aligns to 33:410/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V80), G89 (= G81), G92 (≠ A84), A95 (= A87), V96 (≠ M88), Y99 (≠ F91), M163 (≠ V168), F167 (≠ I172), F293 (≠ L302), V297 (≠ T306)
- binding aspartic acid: S268 (= S278), S269 (= S279), T306 (= T315), G346 (= G355), I347 (= I356), A350 (= A359), G351 (= G360), D380 (≠ S390), R383 (= R393), T384 (≠ A394)
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
28% identity, 86% coverage: 23:402/441 of query aligns to 12:389/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (≠ T66), L58 (≠ V67), L65 (≠ M74), V339 (≠ K351), G340 (= G352), S343 (≠ G355), I344 (= I356)
- binding cholesterol: W188 (≠ K204), I227 (vs. gap), F250 (≠ L260), W257 (≠ L270), M379 (≠ C392), S382 (≠ L395)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S279), M300 (≠ L312), T303 (= T315), Y306 (= Y318), G348 (= G360), L349 (≠ F361), M352 (≠ L364), I366 (≠ M379), L369 (≠ I382), V370 (≠ L383), D373 (= D386), D377 (≠ S390), R380 (= R393), T381 (≠ A394), N384 (= N397)
Sites not aligning to the query:
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
28% identity, 89% coverage: 23:416/441 of query aligns to 20:419/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S278), S281 (= S279), T318 (= T315), G363 (= G360), M367 (≠ L364), V385 (≠ L383), D388 (= D386), R395 (= R393), T396 (≠ A394)
- binding dodecyl beta-D-glucopyranoside: I20 (≠ V23), W389 (≠ R387)
- binding cholesterol hemisuccinate: R80 (= R82), R84 (≠ K86), I95 (≠ L97), I252 (≠ V247)
Sites not aligning to the query:
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
28% identity, 89% coverage: 23:416/441 of query aligns to 19:420/425 of 7xr4A
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
29% identity, 88% coverage: 30:419/441 of query aligns to 25:396/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I71), S80 (≠ V80), G81 (= G81), G84 (≠ A84), Y91 (≠ F91), M156 (≠ V168), F160 (≠ I172), F286 (≠ L302), V290 (≠ T306)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (= I63), I148 (= I160), S262 (= S279), S263 (≠ E280), A292 (≠ Y308), T293 (≠ S309), M296 (≠ L312), T299 (= T315), G329 (= G352), A336 (= A359), G337 (= G360), D366 (≠ S390), R369 (= R393), N373 (= N397)
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
25% identity, 93% coverage: 5:416/441 of query aligns to 19:501/573 of P31596
- K298 (= K220) mutation K->H,R: Normal transporter activity.; mutation K->N,T: Reduced transporter activity.
- H326 (vs. gap) mutation H->N,T,K,R: No transporter activity.
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
25% identity, 93% coverage: 5:416/441 of query aligns to 19:501/572 of P43006
- C38 (vs. gap) modified: S-palmitoyl cysteine; mutation to S: Severely impairs glutamate uptake activity.
8cuaA Human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state (see paper)
28% identity, 85% coverage: 48:422/441 of query aligns to 43:416/416 of 8cuaA
Query Sequence
>SM_b20611 FitnessBrowser__Smeli:SM_b20611
MIIEHSAEVRGKTPLYRHLYVQVLAAIAAGILLGHFYPDIGTELKPLGDAFIRLVKMIIA
PVIFLTVATGIAGMTDLAKVGRVAGKAMIYFLAFSTLALVVGLVVANVVQPGAGMHIDPA
SLDAKAVATYAEKAHEQSITGFLMNIIPTTLVGAFAEGDILQVLFISVLFGISLAIVGKK
AEPVVDFLQALTLPIFRLVAILMKAAPIGAFGAMAFTIGKYGIASIANLAMLIGTFYLTS
FLFVFIVLGAVARYNGFSILSLIRYIKEELLLVLGTSSSEAALPGLMNKMEKAGCKRSVV
GLVIPTGYSFNLDGTNIYMTLAALFIAQATDTPLSYGDQILLLLVAMLSSKGAAGITGAG
FITLAATLSVVPSVPVAGMALILGIDRFMSECRALTNFVGNAVATIVVAKWEGELDQAQL
SAALGGEASVEAIPAVVQPAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory