Comparing SM_b20632 SM_b20632 sugar uptake ABC transporter permease to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
31% identity, 90% coverage: 30:287/287 of query aligns to 26:280/281 of P94530
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
32% identity, 72% coverage: 80:287/287 of query aligns to 85:295/296 of P68183
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
25% identity, 71% coverage: 29:231/287 of query aligns to 46:259/313 of P94529
>SM_b20632 SM_b20632 sugar uptake ABC transporter permease
MRTRREIRARKALRDRIVYHGIGIGTAFFFLAPFAVSFLASFRPNSESGRPPLPPWPISG
LSFDAYRALDSFGAGIWQHMFNSLIVSIGTVVLTVAVSVLAGYGFSRYRFPFKNALFVLI
IATLMIPFQSILTPLFIILARFGLNNSLVGLMLVYVTLQLPFSVFMMRNAFDAVPKEIEE
AARIDGARDLKLLVRVLLPLVMPGIATVSIFAFLNAWNEFFAALVLLSSNDNYTLPVLMT
AVRAGRLGAINWGAVQAGVAVMVVPCLFVFLLLQRYYMRGLMAGAVK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory