Comparing SM_b20633 FitnessBrowser__Smeli:SM_b20633 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
28% identity, 87% coverage: 17:280/305 of query aligns to 17:288/313 of P94529
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
29% identity, 95% coverage: 11:300/305 of query aligns to 2:278/285 of 7cagA
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
26% identity, 76% coverage: 63:295/305 of query aligns to 260:506/514 of P02916
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
26% identity, 76% coverage: 63:294/305 of query aligns to 245:490/490 of 4ki0F
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
37% identity, 30% coverage: 148:238/305 of query aligns to 143:227/296 of P68183
>SM_b20633 FitnessBrowser__Smeli:SM_b20633
MTTSALTSATRRRRPKRQAGWRGLIYIAPAMALVTLFFVLPVLFTLWMSLHKWPLLGEPA
WIGLRNYTRMFTDARFFNALGFTAHYTLIVTIAIFAVAFPLAIFVEKQRPLVSLYRTIVF
LPVVVGLASASLLWVWLANVDSGLFAPLFDMLGLTSGRINLLAKFDTAFLTIIVMVVWKI
AGFTMIILLTGLQAIPAELTEAARIDGAGRWQRFRHLTLPLMRRTMALALILSVTGSILA
FDQFYIMTSGGPQNKMISVVYYIFNQSFVSFNLGYGAALSIALLLILVTLSVVQLWLLKV
GDERP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory