Comparing SM_b20659 FitnessBrowser__Smeli:SM_b20659 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
32% identity, 89% coverage: 18:293/310 of query aligns to 4:271/285 of 7cagA
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
28% identity, 89% coverage: 7:281/310 of query aligns to 15:288/313 of P94529
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
32% identity, 68% coverage: 84:293/310 of query aligns to 269:486/490 of 4ki0F
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
32% identity, 68% coverage: 84:293/310 of query aligns to 284:501/514 of P02916
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
47% identity, 18% coverage: 194:250/310 of query aligns to 182:238/296 of P68183
>SM_b20659 FitnessBrowser__Smeli:SM_b20659
MSSITPSGKPSTTASLMQNNNVLGFLFMLPAAVFLICFLTYPLGLGVWLGFTDTRIGRDG
VFIGIENYEFLARDSVFWLSVYNTLLYTFVASILKFVLGLWLALLLNENLPFKSFFRAIV
LLPWVVPTVLSALAFWWIYDSQFSIISWSLMQLGIIDGPINFLGDPNNARASVIAANVWR
GIPFVAISLLAGLQTIPASLQEAASLDGATSWQRFRYVTLPMLTPIIAVVMTFSVLFTFT
DFQLIYVLTKGGPVNATHLMATLSFQRGIPGGQLGEGAAIAVAMIPFLLAAIMFSFFGLQ
RRKWQQGGQD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory