Comparing SM_b20673 FitnessBrowser__Smeli:SM_b20673 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
44% identity, 96% coverage: 18:521/526 of query aligns to 4:497/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
34% identity, 41% coverage: 17:231/526 of query aligns to 1:211/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
31% identity, 41% coverage: 18:234/526 of query aligns to 3:216/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
31% identity, 41% coverage: 18:234/526 of query aligns to 3:216/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
31% identity, 41% coverage: 18:234/526 of query aligns to 3:216/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
31% identity, 41% coverage: 18:234/526 of query aligns to 3:216/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 40% coverage: 24:231/526 of query aligns to 7:212/240 of 4ymuJ
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 41% coverage: 18:232/526 of query aligns to 4:227/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 41% coverage: 18:232/526 of query aligns to 4:227/253 of 1g9xB
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
32% identity, 41% coverage: 18:231/526 of query aligns to 3:218/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
32% identity, 41% coverage: 18:231/526 of query aligns to 3:218/592 of 5lj7A
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
33% identity, 44% coverage: 270:503/526 of query aligns to 1:230/250 of 7z18I
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
33% identity, 44% coverage: 270:503/526 of query aligns to 1:230/253 of 7z15I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
33% identity, 44% coverage: 270:503/526 of query aligns to 1:230/250 of 7z16I
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
31% identity, 53% coverage: 17:296/526 of query aligns to 3:255/648 of P75831
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
30% identity, 41% coverage: 18:234/526 of query aligns to 3:217/223 of 2pclA
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
29% identity, 46% coverage: 24:265/526 of query aligns to 12:259/375 of 2d62A
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
28% identity, 40% coverage: 24:232/526 of query aligns to 8:226/258 of 1b0uA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
28% identity, 40% coverage: 24:232/526 of query aligns to 12:230/258 of P02915
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
26% identity, 46% coverage: 17:259/526 of query aligns to 16:256/378 of P69874
Sites not aligning to the query:
>SM_b20673 FitnessBrowser__Smeli:SM_b20673
MRDAIPRDSVTTESDRPILAAEAISKSFGGVAALKDVRFELRAGEIHALMGENGAGKSTL
MKVLSGVYTDYEGAVRVDGETVRFSNVRDAEAAGIAIIHQELNLVPELGVADNIFLGRER
VIAGLFVDRKASLEAARGLLNRLGIELDPEARVGQLRVGEQQLVEIAKALSVEARILIMD
EPTSALSPGECRRLFKIMRQLAADGVGIIYISHRIDEVMQLSDRVTVFRDGRHVWARPMA
GLDENTIIAAMVGRNLLDAHRRDRGKGGGEPVLSVRDLSLAVSGRHGWRDVLKGVSFDVR
AGEILGIGGLLGAGRTEILETIFASNEGLRGGEIRLDGIAVNIRSPRDARRLGFALVTED
RKAKGLHLHESIRDNVALPLVGRLARFGLRSFEGERALAKGAVDALGVRCAGTGQAAGTL
SGGNQQKVVIGKWLATGPRVLLLDEPTRGIDVGAKREIYDLIFKLAGDGLAIVVVSSELP
ELLLLADRILVMAEGRQTGLISREEASEERIMQLAAPRSARGRAVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory