Comparing SM_b20713 FitnessBrowser__Smeli:SM_b20713 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
47% identity, 96% coverage: 21:511/513 of query aligns to 2:491/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 41% coverage: 29:239/513 of query aligns to 8:214/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 42% coverage: 23:239/513 of query aligns to 3:216/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 42% coverage: 23:239/513 of query aligns to 3:216/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
28% identity, 42% coverage: 23:239/513 of query aligns to 3:216/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
28% identity, 42% coverage: 23:239/513 of query aligns to 3:216/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 41% coverage: 29:236/513 of query aligns to 7:212/240 of 4ymuJ
5x40A Structure of a cbio dimer bound with amppcp (see paper)
30% identity, 44% coverage: 23:250/513 of query aligns to 4:230/280 of 5x40A
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
28% identity, 52% coverage: 21:288/513 of query aligns to 2:270/285 of 4yerA
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 42% coverage: 23:239/513 of query aligns to 4:229/254 of 1g6hA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 41% coverage: 36:247/513 of query aligns to 18:228/343 of P30750
Sites not aligning to the query:
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 42% coverage: 23:239/513 of query aligns to 4:229/253 of 1g9xB
3d31A Modbc from methanosarcina acetivorans (see paper)
29% identity, 39% coverage: 38:239/513 of query aligns to 15:207/348 of 3d31A
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
29% identity, 41% coverage: 36:247/513 of query aligns to 19:229/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
29% identity, 41% coverage: 36:247/513 of query aligns to 19:229/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
29% identity, 41% coverage: 36:247/513 of query aligns to 19:229/344 of 3tuiC
Sites not aligning to the query:
1yqtA Rnase-l inhibitor (see paper)
25% identity, 87% coverage: 46:489/513 of query aligns to 21:453/515 of 1yqtA
Sites not aligning to the query:
5yv5A Crystal structure of the complex of archaeal ribosomal stalk protein ap1 and archaeal ribosome recycling factor aabce1. (see paper)
25% identity, 86% coverage: 46:488/513 of query aligns to 24:455/517 of 5yv5A
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
27% identity, 44% coverage: 276:499/513 of query aligns to 3:230/250 of 7z18I
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
27% identity, 44% coverage: 276:499/513 of query aligns to 3:230/253 of 7z15I
>SM_b20713 FitnessBrowser__Smeli:SM_b20713
MTLSPTTMAAVRASGAVPKSEYLLTAEGVRKEFPGVVALDDVEFKLKRGTVHALMGENGA
GKSTLMKILAGIYYPDQGEVKLRGAGIRLKSPLDALENGIAMIHQELNLMPFMTVAENIW
IRREPKNRFGFVDHGEMRRMTAKLFERLKIDLDPEIEVRHLSVANRQMVEIAKAVSYESD
VLIMDEPTSALTEREVAHLFEIIRDLRSQGIGIVYITHKMNELFEIADEFSVFRDGKYIG
THLSNEVTRDDIIRMMVGREITQMFPKEEVPIGDVVLSVKNLTLNGVFRDVSFDVRAGEI
LGVAGLVGSGRSNVAETLFGVTPASSGTIAIDGKEVVIDSANKAIRHRMAFLTEDRKDTG
CLLILDILENMQIAVLQDKFVKRGFVSEREVTAACEEMSRKLRVKTPNLQERVENLSGGN
QQKVLIGRWLLTNPRILILDEPTRGIDVGAKAEIHRLVTELARNGVAVIMISSEMPEVLG
MSDRIMVMHEGRVTGILDRAEATQIKVMELAAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory