Comparing SM_b20718 FitnessBrowser__Smeli:SM_b20718 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
41% identity, 96% coverage: 12:501/508 of query aligns to 4:493/501 of P04983
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
30% identity, 50% coverage: 4:259/508 of query aligns to 3:260/265 of P07821
3c4jA Abc protein artp in complex with atp-gamma-s
31% identity, 43% coverage: 12:227/508 of query aligns to 3:216/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
31% identity, 43% coverage: 12:227/508 of query aligns to 3:216/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
31% identity, 43% coverage: 12:227/508 of query aligns to 3:216/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
31% identity, 43% coverage: 12:227/508 of query aligns to 3:216/242 of 2oljA
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
29% identity, 63% coverage: 13:332/508 of query aligns to 4:296/350 of 3fvqB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
26% identity, 43% coverage: 12:227/508 of query aligns to 4:229/254 of 1g6hA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 42% coverage: 18:228/508 of query aligns to 7:216/240 of 4ymuJ
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
26% identity, 43% coverage: 12:227/508 of query aligns to 4:229/253 of 1g9xB
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 41% coverage: 18:225/508 of query aligns to 23:225/378 of P69874
Sites not aligning to the query:
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
31% identity, 45% coverage: 10:238/508 of query aligns to 3:233/233 of P75957
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
29% identity, 43% coverage: 12:228/508 of query aligns to 2:216/241 of 4u00A
7mdyC Lolcde nucleotide-bound
31% identity, 44% coverage: 11:234/508 of query aligns to 1:226/226 of 7mdyC
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
31% identity, 43% coverage: 12:229/508 of query aligns to 4:224/648 of P75831
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
30% identity, 44% coverage: 10:235/508 of query aligns to 2:229/229 of 7v8iD
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 41% coverage: 25:233/508 of query aligns to 18:226/343 of P30750
Sites not aligning to the query:
4hluC Structure of the ecfa-a' heterodimer bound to adp (see paper)
31% identity, 42% coverage: 13:224/508 of query aligns to 5:208/249 of 4hluC
7arlD Lolcde in complex with lipoprotein and adp (see paper)
30% identity, 43% coverage: 11:227/508 of query aligns to 1:221/222 of 7arlD
8g4cB Bceabs atpgs high res tm (see paper)
29% identity, 43% coverage: 10:225/508 of query aligns to 1:220/248 of 8g4cB
>SM_b20718 FitnessBrowser__Smeli:SM_b20718
MNPETVDAARVVLEARRISKSFSGVQVLFSVNFELRAGEIHALMGENGAGKSTLVKILSG
FEQPSSGEVLLDGQPVTLPANGAAEALGIVIIHQEFNLAEHLTVAESLFLGREVTRFGVL
DRKYMRAETRRVLDLLGCHVDANALIGSLSIAEKQMVEIAKAISRDARIVFMDEPTAVLS
REETNFLFRQVRKLRDRGTSFVFVSHKLDEVIELTDRVTVLRDGQWVKTAATSMLDGESI
AQLMVGREMSSLFPAKKEPNVDEEVVLRVDAVSTDYVQDARFEVRKGEILGFSGMIGSGR
TELMEAVAGLRPRLSGEVTIRGETVPSGDVHAANRRGLAYMTKDRKAKGLLLNSGMTANL
TLQSLGRHARIGYLSPASEAAALKRARRRFDIRVRDGNVVARRMSGGNQQKLLLAKVMET
EPDIIIIDEPTRGIDVGTKQQIYHFISALARDGRSIIVVSSEMPEVIGLCTRVAVMREGR
IVGMLEGDEISEQEIMRYAAGLKKMAAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory