Comparing SM_b20724 FitnessBrowser__Smeli:SM_b20724 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
2dvzA Structure of a periplasmic transporter (see paper)
28% identity, 44% coverage: 103:239/314 of query aligns to 89:223/300 of 2dvzA
Sites not aligning to the query:
2f5xB Structure of periplasmic binding protein bugd (see paper)
29% identity, 68% coverage: 24:235/314 of query aligns to 8:217/300 of 2f5xB
7ndsA Crystal structure of tphc in a closed conformation (see paper)
23% identity, 67% coverage: 25:233/314 of query aligns to 7:213/294 of 7ndsA
Sites not aligning to the query:
7ndrD Crystal structure of tphc in an open conformation (see paper)
23% identity, 67% coverage: 25:233/314 of query aligns to 7:213/293 of 7ndrD
6hkeB Matc (rpa3494) from rhodopseudomonas palustris with bound malate (see paper)
27% identity, 65% coverage: 32:236/314 of query aligns to 15:218/296 of 6hkeB
Sites not aligning to the query:
5okuA R. Palustris rpa4515 with adipate (see paper)
24% identity, 74% coverage: 24:255/314 of query aligns to 8:239/299 of 5okuA
5oeiA R. Palustris rpa4515 with oxoadipate (see paper)
24% identity, 74% coverage: 24:255/314 of query aligns to 8:239/299 of 5oeiA
>SM_b20724 FitnessBrowser__Smeli:SM_b20724
MKHFFLASILAGAIALPAYAADYTIIAPANPGGGWDQTARSLQTVMQQEGISGNVQVQNV
PGAGGTIGLAQFASQQKGNPNALLVGGYVMVGAILTNNSPVTLKDVTPIARLTGEYEAIV
VPAASEIQTMKDLVEALKKDPGAVSWAGGSAGGTDHIAVGLIAKAAGVDPTKINYIAYSG
GGEALAAILGNQVTAGISGYGEFESQVKAGTLRLLAVSSAERLEGIDAPTLKESGVDVVV
ENWRMVAAAPGLTEEQKAAVSADIEKLAKSAGWQEVLKTKGWQDTYLAGAAFDEQLAKDI
SATETVLKDIGLVK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory