SitesBLAST
Comparing SM_b20753 SM_b20753 acyl-CoA dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1rx0C Crystal structure of isobutyryl-coa dehydrogenase complexed with substrate/ligand. (see paper)
56% identity, 98% coverage: 5:377/380 of query aligns to 9:381/383 of 1rx0C
- active site: L128 (= L124), T129 (= T125), G244 (= G240), E366 (= E362), R378 (= R374)
- binding methacrylyl-coenzyme a: I93 (= I89), Y126 (= Y122), S135 (= S131), V238 (≠ M234), L241 (= L237), N242 (≠ D238), R245 (= R241), V316 (≠ T312), E366 (= E362), G367 (= G363), L375 (≠ I371), R378 (= R374)
- binding flavin-adenine dinucleotide: Y126 (= Y122), L128 (= L124), T129 (= T125), G134 (= G130), S135 (= S131), F159 (= F155), I160 (= I156), S161 (= S157), R270 (= R266), F273 (= F269), N280 (≠ F276), L283 (= L279), Q339 (= Q335), M340 (≠ L336), G342 (= G338), G343 (= G339), Y344 (= Y340), L365 (= L361), S368 (≠ T364), E370 (= E366)
1rx0A Crystal structure of isobutyryl-coa dehydrogenase complexed with substrate/ligand. (see paper)
56% identity, 98% coverage: 5:377/380 of query aligns to 10:382/384 of 1rx0A
- active site: L129 (= L124), T130 (= T125), G245 (= G240), E367 (= E362), R379 (= R374)
- binding flavin-adenine dinucleotide: Y127 (= Y122), L129 (= L124), T130 (= T125), G135 (= G130), S136 (= S131), F160 (= F155), I161 (= I156), S162 (= S157), W207 (= W202), R271 (= R266), F274 (= F269), L278 (≠ I273), N281 (≠ F276), L284 (= L279), Q340 (= Q335), M341 (≠ L336), G343 (= G338), G344 (= G339), Y345 (= Y340), L366 (= L361), S369 (≠ T364), E371 (= E366)
Q9UKU7 Isobutyryl-CoA dehydrogenase, mitochondrial; IBDH; Activator-recruited cofactor 42 kDa component; ARC42; Acyl-CoA dehydrogenase family member 8; ACAD-8; EC 1.3.8.5 from Homo sapiens (Human) (see 3 papers)
56% identity, 98% coverage: 5:377/380 of query aligns to 41:413/415 of Q9UKU7
- G137 (= G101) to R: in IBDD; loss of protein solubility; complete loss of isobutyryl-CoA dehydrogenase activity; dbSNP:rs371449613
- 158:167 (vs. 122:131, 100% identical) binding in other chain
- S167 (= S131) binding
- FIS 191:193 (= FIS 155:157) binding in other chain
- NGGR 274:277 (≠ DGGR 238:241) binding
- R302 (= R266) binding ; to Q: in IBDD; no effect on localization to the mitochondrion; complete loss of isobutyryl-CoA dehydrogenase activity; loss of protein expression in patient cells; dbSNP:rs121908422
- NQ 312:313 (≠ FQ 276:277) binding
- A320 (= A284) to T: in IBDD; decreased isobutyryl-CoA dehydrogenase activity; less than 20% of wild-type; dbSNP:rs200620279
- QMHGG 371:375 (≠ QLHGG 335:339) binding
- SNE 400:402 (≠ TNE 364:366) binding in other chain
- R410 (= R374) binding
1ukwB Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
42% identity, 99% coverage: 1:377/380 of query aligns to 1:377/379 of 1ukwB
- active site: L124 (= L124), S125 (≠ T125), T241 (≠ G240), E362 (= E362), R374 (= R374)
- binding cobalt (ii) ion: D145 (= D145), H146 (≠ A146)
- binding flavin-adenine dinucleotide: F122 (≠ Y122), L124 (= L124), S125 (≠ T125), G130 (= G130), S131 (= S131), W155 (≠ F155), S157 (= S157), K200 (= K199), L357 (≠ V357), Y361 (≠ L361), E362 (= E362), T364 (= T364), E366 (= E366), L370 (= L370)
1ukwA Crystal structure of medium-chain acyl-coa dehydrogenase from thermus thermophilus hb8
42% identity, 99% coverage: 1:377/380 of query aligns to 1:377/379 of 1ukwA
- active site: L124 (= L124), S125 (≠ T125), T241 (≠ G240), E362 (= E362), R374 (= R374)
- binding flavin-adenine dinucleotide: F122 (≠ Y122), L124 (= L124), S125 (≠ T125), G130 (= G130), S131 (= S131), W155 (≠ F155), S157 (= S157), L357 (≠ V357), Y361 (≠ L361), E362 (= E362), T364 (= T364), E366 (= E366), L370 (= L370)
8i4rA Crystal structure of acyl-coa dehydrogenase complexed with acetyl-coa from thermobifida fusca
42% identity, 99% coverage: 3:377/380 of query aligns to 4:380/381 of 8i4rA
- binding acetyl coenzyme *a: S132 (= S131), T134 (≠ A133), R180 (vs. gap), R234 (= R231), L237 (≠ M234), R238 (≠ A235), L240 (= L237), D241 (= D238), R244 (= R241), E365 (= E362), G366 (= G363), R377 (= R374)
- binding flavin-adenine dinucleotide: Y123 (= Y122), L125 (= L124), S126 (≠ T125), G131 (= G130), S132 (= S131), W156 (≠ F155), I157 (= I156), T158 (≠ S157), I360 (≠ V357), T367 (= T364), Q369 (≠ E366)
8i4pA Crystal structure of acyl-coa dehydrogenase from thermobifida fusca
42% identity, 99% coverage: 3:377/380 of query aligns to 4:380/381 of 8i4pA
- binding flavin-adenine dinucleotide: Y123 (= Y122), L125 (= L124), S126 (≠ T125), G131 (= G130), S132 (= S131), W156 (≠ F155), I157 (= I156), T158 (≠ S157), I360 (≠ V357), Y364 (≠ L361), T367 (= T364), Q369 (≠ E366)
7w0jE Acyl-coa dehydrogenase, tfu_1647
42% identity, 99% coverage: 3:377/380 of query aligns to 5:381/382 of 7w0jE
- binding [[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2R,3S,4S)-5-azanyl-2,3,4-tris(oxidanyl)pentyl] hydrogen phosphate: S127 (≠ T125), W157 (≠ F155), R270 (= R266), Q272 (≠ A268), F273 (= F269), I277 (= I273), F280 (= F276), I283 (≠ L279), Q339 (= Q335), L340 (= L336), G343 (= G339), Y365 (≠ L361), E366 (= E362), T368 (= T364), Q370 (≠ E366), I371 (= I367)
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
41% identity, 99% coverage: 1:377/380 of query aligns to 1:377/378 of 5ol2F
- active site: L124 (= L124), T125 (= T125), G241 (= G240), G374 (≠ R374)
- binding calcium ion: E29 (≠ D30), E33 (≠ Q34), R35 (≠ H36)
- binding coenzyme a persulfide: L238 (= L237), R242 (= R241), E362 (= E362), G363 (= G363)
- binding flavin-adenine dinucleotide: F122 (≠ Y122), L124 (= L124), T125 (= T125), P127 (= P127), T131 (≠ S131), F155 (= F155), I156 (= I156), T157 (≠ S157), E198 (= E197), R267 (= R266), F270 (= F269), L274 (≠ I273), F277 (= F276), Q335 (= Q335), L336 (= L336), G338 (= G338), G339 (= G339), Y361 (≠ L361), T364 (= T364), E366 (= E366)
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
41% identity, 99% coverage: 1:377/380 of query aligns to 1:378/380 of 4l1fA
- active site: L125 (= L124), T126 (= T125), G242 (= G240), E363 (= E362), R375 (= R374)
- binding coenzyme a persulfide: T132 (≠ S131), H179 (≠ K177), F232 (= F230), M236 (= M234), E237 (≠ A235), L239 (= L237), D240 (= D238), R243 (= R241), Y362 (≠ L361), E363 (= E362), G364 (= G363), R375 (= R374)
- binding flavin-adenine dinucleotide: F123 (≠ Y122), L125 (= L124), T126 (= T125), G131 (= G130), T132 (≠ S131), F156 (= F155), I157 (= I156), T158 (≠ S157), R268 (= R266), Q270 (≠ A268), F271 (= F269), I275 (= I273), F278 (= F276), L281 (= L279), Q336 (= Q335), I337 (≠ L336), G340 (= G339), I358 (≠ V357), Y362 (≠ L361), T365 (= T364), Q367 (≠ E366)
- binding 1,3-propandiol: L5 (= L5), Q10 (≠ E10)
5lnxD Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
41% identity, 98% coverage: 7:378/380 of query aligns to 4:374/374 of 5lnxD
- active site: L122 (= L124), T123 (= T125), G239 (= G240), E358 (= E362), K370 (≠ R374)
- binding flavin-adenine dinucleotide: L122 (= L124), T123 (= T125), G128 (= G130), S129 (= S131), F153 (= F155), T155 (≠ S157), R265 (= R266), Q267 (≠ A268), F268 (= F269), I272 (= I273), N275 (≠ F276), I278 (≠ L279), Q331 (= Q335), I332 (≠ L336), G335 (= G339), Y357 (≠ L361), T360 (= T364), E362 (= E366)
3mdeA Crystal structures of medium chain acyl-coa dehydrogenase from pig liver mitochondria with and without substrate (see paper)
37% identity, 100% coverage: 1:379/380 of query aligns to 2:383/385 of 3mdeA
- active site: V125 (≠ L124), T126 (= T125), T245 (≠ G240), E366 (= E362), R378 (= R374)
- binding octanoyl-coenzyme a: T86 (≠ S85), E89 (≠ S88), L93 (≠ M92), S132 (= S131), V134 (≠ A133), S181 (≠ P176), F235 (= F230), M239 (= M234), F242 (≠ L237), R314 (≠ E310), Y365 (≠ L361), E366 (= E362), G367 (= G363)
- binding flavin-adenine dinucleotide: Y123 (= Y122), V125 (≠ L124), T126 (= T125), G131 (= G130), S132 (= S131), W156 (≠ F155), I157 (= I156), T158 (≠ S157), R271 (= R266), T273 (≠ A268), F274 (= F269), L278 (≠ I273), H281 (≠ F276), Q339 (= Q335), V340 (≠ L336), G343 (= G339), I361 (≠ V357), T368 (= T364), Q370 (≠ E366)
3mddA Crystal structures of medium chain acyl-coa dehydrogenase from pig liver mitochondria with and without substrate (see paper)
37% identity, 100% coverage: 1:379/380 of query aligns to 2:383/385 of 3mddA
- active site: V125 (≠ L124), T126 (= T125), T245 (≠ G240), E366 (= E362), R378 (= R374)
- binding flavin-adenine dinucleotide: Y123 (= Y122), T126 (= T125), G131 (= G130), S132 (= S131), W156 (≠ F155), T158 (≠ S157), R271 (= R266), T273 (≠ A268), F274 (= F269), H281 (≠ F276), Q339 (= Q335), V340 (≠ L336), G343 (= G339), I361 (≠ V357), T368 (= T364), Q370 (≠ E366)
1udyA Medium-chain acyl-coa dehydrogenase with 3-thiaoctanoyl-coa (see paper)
37% identity, 100% coverage: 1:379/380 of query aligns to 2:383/385 of 1udyA
- active site: V125 (≠ L124), T126 (= T125), T245 (≠ G240), E366 (= E362), R378 (= R374)
- binding 3-thiaoctanoyl-coenzyme a: L93 (≠ M92), Y123 (= Y122), S132 (= S131), S181 (≠ P176), F235 (= F230), M239 (= M234), F242 (≠ L237), V249 (≠ I244), R314 (≠ E310), Y365 (≠ L361), E366 (= E362), G367 (= G363), I371 (= I367), I375 (= I371)
- binding flavin-adenine dinucleotide: Y123 (= Y122), T126 (= T125), G131 (= G130), S132 (= S131), W156 (≠ F155), T158 (≠ S157), T273 (≠ A268), F274 (= F269), Q339 (= Q335), V340 (≠ L336), G343 (= G339), T368 (= T364), Q370 (≠ E366)
2a1tC Structure of the human mcad:etf e165betaa complex (see paper)
38% identity, 98% coverage: 1:374/380 of query aligns to 4:380/388 of 2a1tC
- active site: V127 (≠ L124), T128 (= T125), T247 (≠ G240), E368 (= E362), R380 (= R374)
- binding flavin-adenine dinucleotide: Y125 (= Y122), V127 (≠ L124), T128 (= T125), G133 (= G130), S134 (= S131), Q155 (= Q152), W158 (≠ F155), W158 (≠ F155), I159 (= I156), T160 (≠ S157), R273 (= R266), T275 (≠ A268), F276 (= F269), L280 (≠ I273), H283 (≠ F276), I286 (≠ L279), Q341 (= Q335), I342 (≠ L336), G345 (= G339), I363 (≠ V357), T370 (= T364), Q372 (≠ E366)
P41367 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial; MCAD; EC 1.3.8.7 from Sus scrofa (Pig) (see 2 papers)
37% identity, 100% coverage: 1:379/380 of query aligns to 37:418/421 of P41367
- 158:167 (vs. 122:131, 80% identical) binding in other chain
- S167 (= S131) binding
- WIT 191:193 (≠ FIS 155:157) binding in other chain
- S216 (≠ P176) binding
- D278 (= D238) binding
- R281 (= R241) binding
- RKT 306:308 (≠ RRA 266:268) binding
- HQ 316:317 (≠ FQ 276:277) binding in other chain
- R349 (≠ E310) binding
- T351 (= T312) binding
- QVFGG 374:378 (≠ QLHGG 335:339) binding
- E401 (= E362) active site, Proton acceptor; binding
- GTAQ 402:405 (≠ GTNE 363:366) binding in other chain
P11310 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial; MCAD; Medium chain acyl-CoA dehydrogenase; MCADH; EC 1.3.8.7 from Homo sapiens (Human) (see 16 papers)
38% identity, 98% coverage: 1:374/380 of query aligns to 37:413/421 of P11310
- Y67 (≠ W31) to H: in ACADMD; mild; dbSNP:rs121434280
- L86 (≠ M50) mutation to M: Strongly reduced rate of electron transfer to ETF.
- L98 (≠ T62) mutation to W: Strongly reduced rate of electron transfer to ETF.
- L100 (= L64) mutation to Y: Strongly reduced rate of electron transfer to ETF.
- I108 (= I72) mutation to M: Strongly reduced rate of electron transfer to ETF.
- P132 (≠ M96) to R: in a breast cancer sample; somatic mutation; dbSNP:rs875989854
- 158:167 (vs. 122:131, 80% identical) binding in other chain
- S167 (= S131) binding
- W191 (≠ F155) mutation to A: Loss of electron transfer to ETF.; mutation to F: Reduces rate of electron transfer to ETF about six-fold.
- WIT 191:193 (≠ FIS 155:157) binding in other chain
- T193 (≠ S157) to A: in ACADMD; the thermostability is markedly decreased; dbSNP:rs121434279
- E237 (= E197) mutation to A: Strongly reduced rate of electron transfer to ETF.
- D278 (= D238) binding
- T280 (≠ G240) mutation to E: Narrower substrate specificity. Changed substrate specificity towards longer acyl chains; when associated with G-401. Loss of acyl-CoA dehydrogenase activity; when associated with T-410.
- R281 (= R241) binding ; to T: in ACADMD; mild clinical phenotype; dbSNP:rs121434282
- RKT 306:308 (≠ RRA 266:268) binding
- HQ 316:317 (≠ FQ 276:277) binding in other chain
- K329 (≠ D289) to E: in ACADMD; may alter splicing; decreased fatty acid beta-oxidation; dbSNP:rs77931234
- QILGG 374:378 (≠ QLHGG 335:339) binding
- E384 (≠ D345) mutation to A: Reduces rate of electron transfer to ETF three-fold.; mutation to Q: Reduces rate of electron transfer to ETF two-fold.
- E401 (= E362) active site, Proton acceptor; binding ; mutation to G: Changed substrate specificity towards longer acyl chains; when associated with E-280.; mutation to Q: Loss of acyl-CoA dehydrogenase activity.; mutation to T: Loss of acyl-CoA dehydrogenase activity; when associated with E-280.
- EGTSQ 401:405 (≠ EGTNE 362:366) binding in other chain
1egcA Structure of t255e, e376g mutant of human medium chain acyl-coa dehydrogenase complexed with octanoyl-coa (see paper)
38% identity, 98% coverage: 1:374/380 of query aligns to 3:379/387 of 1egcA
- active site: V126 (≠ L124), T127 (= T125), E246 (≠ G240), G367 (≠ E362), R379 (= R374)
- binding octanoyl-coenzyme a: E90 (≠ S88), L94 (≠ M92), Y124 (= Y122), S133 (= S131), V135 (≠ A133), N182 (≠ P176), F236 (= F230), M240 (= M234), F243 (≠ L237), D244 (= D238), R247 (= R241), Y366 (≠ L361), G367 (≠ E362), G368 (= G363)
- binding flavin-adenine dinucleotide: Y124 (= Y122), V126 (≠ L124), T127 (= T125), G132 (= G130), S133 (= S131), W157 (≠ F155), T159 (≠ S157), R272 (= R266), T274 (≠ A268), F275 (= F269), L279 (≠ I273), H282 (≠ F276), I285 (≠ L279), Q340 (= Q335), I341 (≠ L336), G344 (= G339), I362 (≠ V357), I365 (= I360), Y366 (≠ L361), T369 (= T364), Q371 (≠ E366)
4n5fA Crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315
41% identity, 99% coverage: 1:376/380 of query aligns to 2:378/378 of 4n5fA
- active site: L126 (= L124), T127 (= T125), G243 (= G240), E364 (= E362), R376 (= R374)
- binding dihydroflavine-adenine dinucleotide: L126 (= L124), T127 (= T125), G132 (= G130), S133 (= S131), F157 (= F155), T159 (≠ S157), T210 (= T207), Y363 (≠ L361), T366 (= T364), E368 (= E366), M372 (≠ L370)
Q9VSA3 Medium-chain specific acyl-CoA dehydrogenase, mitochondrial; EC 1.3.8.7 from Drosophila melanogaster (Fruit fly) (see paper)
39% identity, 98% coverage: 3:374/380 of query aligns to 35:409/419 of Q9VSA3
- S347 (≠ T312) modified: Phosphoserine; by Pink1; mutation to A: Prevents phosphorylation by Pink1. Does not rescue climbing and flight defects in Pink1 mutants.; mutation to D: Phosphomimetic mutant that fully rescues climbing defects and significantly improves flight defects, and thorax and wing posture phenotypes in Pink1 mutants. No effect on acyl-CoA dehydrogenase activity.; mutation to DD: Phosphomimetic mutant that fully rescues climbing defects and significantly improves flight defects, and thorax and wing posture phenotypes in Pink1 mutants. No effect on acyl-CoA dehydrogenase activity.
Query Sequence
>SM_b20753 SM_b20753 acyl-CoA dehydrogenase
MDFRLSEEQEAIRTMALDFARDEIAPHAVDWDQQKHFPVETLRAAAALGMAGIYIRDDVG
GTGLTRLDAAMIIEALATGCPAIASFVSIHNMCAGMIDRYGTDEQRRRLLPPLLTMDVLA
SYCLTEPGSGSDAAALKTRAVREGDAYLLTGQKQFISGAGESGLYIVMARTGEEGPKGIS
AFVVEKDAPGLTFGANEKKMGWHAQPTRAVMLDNVRVSVENRLGAEGEGFRIAMAGLDGG
RLSIAAASLGGAQSAFDKALAYVQERRAFGKAIGEFQALQFRLADMATDLEIARTFLWRA
ACALDAADPEATKLCAMAKRFVTDRCFSVANDALQLHGGYGYLADYGVEKIVRDLRVHQI
LEGTNEIMRLIVSRAIMGRK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory