Comparing SM_b20785 FitnessBrowser__Smeli:SM_b20785 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 95% coverage: 4:245/254 of query aligns to 4:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 96% coverage: 4:246/254 of query aligns to 4:254/254 of 1g6hA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 93% coverage: 4:238/254 of query aligns to 2:228/241 of 4u00A
6mbnA Lptb e163q in complex with atp (see paper)
33% identity, 96% coverage: 2:246/254 of query aligns to 1:237/241 of 6mbnA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
33% identity, 96% coverage: 3:245/254 of query aligns to 1:235/235 of 6mhzA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
33% identity, 96% coverage: 3:246/254 of query aligns to 1:236/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
33% identity, 96% coverage: 3:246/254 of query aligns to 1:236/238 of 6s8gA
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 93% coverage: 4:238/254 of query aligns to 3:230/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 93% coverage: 4:238/254 of query aligns to 3:230/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 93% coverage: 4:238/254 of query aligns to 3:230/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 93% coverage: 4:238/254 of query aligns to 3:230/242 of 2oljA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
33% identity, 95% coverage: 3:244/254 of query aligns to 1:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
33% identity, 95% coverage: 3:244/254 of query aligns to 1:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
32% identity, 95% coverage: 3:243/254 of query aligns to 1:233/233 of 6b8bA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
29% identity, 96% coverage: 3:246/254 of query aligns to 1:236/240 of 6mjpA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 93% coverage: 7:241/254 of query aligns to 4:234/240 of 4ymuJ
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
28% identity, 96% coverage: 2:246/254 of query aligns to 2:243/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
28% identity, 96% coverage: 2:246/254 of query aligns to 2:243/263 of 7d08B
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
28% identity, 96% coverage: 3:246/254 of query aligns to 1:241/253 of 6z5uK
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 94% coverage: 1:238/254 of query aligns to 14:240/378 of P69874
Sites not aligning to the query:
>SM_b20785 FitnessBrowser__Smeli:SM_b20785
MSAIFEVRNLKRSFGGLAVTNDVSLSMAPGDRVALIGPNGAGKTTFVNLVTGNLKPDAGE
VRIGGETVTNVDAIGRVRRGLVRSFQVTRLFQDMTPAEHVALAVLQRDGRAGRMFGNFLA
MPGVMAEAGSLLGKLGLRDLAHRPVREIAYGQQRLLEIAVALALKPRVLLLDEPAAGVPQ
SDTGRIEQALADLPDDLAVLMIEHDMDLVFRFAKRVIVLAAGTVIFDGSPADVTKDPRVR
EAYLGSYADAGSAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory