SitesBLAST
Comparing SM_b20820 FitnessBrowser__Smeli:SM_b20820 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2yvjA Crystal structure of the ferredoxin-ferredoxin reductase (bpha3-bpha4)complex (see paper)
42% identity, 99% coverage: 4:409/409 of query aligns to 6:401/402 of 2yvjA
- active site: L13 (≠ E11), R44 (= R42), P45 (= P43), Q291 (= Q297)
- binding flavin-adenine dinucleotide: G10 (= G8), G12 (= G10), G35 (= G33), D36 (≠ A34), E37 (= E35), R44 (= R42), P45 (= P43), A78 (= A78), T105 (= T105), G106 (= G106), R126 (= R126), G268 (≠ P277), D269 (≠ S278), T286 (≠ A292), W287 (= W293), A290 (= A296), W316 (= W321)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V147 (≠ I147), G148 (= G148), G149 (= G149), G150 (= G150), I152 (= I152), V170 (= V170), E171 (= E171), T172 (≠ G172), R179 (= R179), G230 (= G234), I231 (= I235), G232 (= G236), V233 (≠ A237), E285 (= E291)
1f3pA Ferredoxin reductase (bpha4)-nadh complex (see paper)
42% identity, 99% coverage: 4:409/409 of query aligns to 6:401/401 of 1f3pA
- active site: L13 (≠ E11), R44 (= R42), P45 (= P43), Q291 (= Q297)
- binding flavin-adenine dinucleotide: A14 (≠ C12), V34 (≠ T32), D36 (≠ A34), E37 (= E35), R44 (= R42), P45 (= P43), A78 (= A78), T105 (= T105), G106 (= G106), R126 (= R126), G268 (≠ P277), D269 (≠ S278), E285 (= E291), T286 (≠ A292), W287 (= W293), A290 (= A296), W316 (= W321)
- binding nicotinamide-adenine-dinucleotide: V147 (≠ I147), G148 (= G148), G150 (= G150), V151 (≠ F151), I152 (= I152), E155 (= E155), E171 (= E171), T172 (≠ G172), R179 (= R179), G230 (= G234), I231 (= I235), G232 (= G236), V233 (≠ A237), E285 (= E291), W316 (= W321), S317 (= S322)
2gr2A Crystal structure of ferredoxin reductase, bpha4 (oxidized form)
42% identity, 99% coverage: 4:409/409 of query aligns to 5:400/401 of 2gr2A
- active site: L12 (≠ E11), R43 (= R42), P44 (= P43), Q290 (= Q297)
- binding adenosine-5-diphosphoribose: R109 (= R110), V146 (≠ I147), G147 (= G148), G149 (= G150), V150 (≠ F151), I151 (= I152), E170 (= E171), T171 (≠ G172), R178 (= R179), G229 (= G234), I230 (= I235), G231 (= G236), E284 (= E291)
- binding flavin-adenine dinucleotide: G11 (= G10), A13 (≠ C12), D35 (≠ A34), E36 (= E35), R43 (= R42), P44 (= P43), K48 (= K47), A77 (= A78), T104 (= T105), G105 (= G106), R125 (= R126), G267 (≠ P277), D268 (≠ S278), T285 (≠ A292), W286 (= W293), A289 (= A296), W315 (= W321)
2gr0A Crystal structure of ferredoxin reductase, bpha4 (oxidized form, NAD+ complex) (see paper)
42% identity, 99% coverage: 4:409/409 of query aligns to 5:400/401 of 2gr0A
- active site: L12 (≠ E11), R43 (= R42), P44 (= P43), Q290 (= Q297)
- binding adenosine-5'-diphosphate: V146 (≠ I147), G147 (= G148), G149 (= G150), I151 (= I152), E170 (= E171), T171 (≠ G172), R178 (= R179), G229 (= G234), I230 (= I235), G231 (= G236)
- binding flavin-adenine dinucleotide: G11 (= G10), A13 (≠ C12), D35 (≠ A34), E36 (= E35), R43 (= R42), P44 (= P43), K48 (= K47), T76 (= T77), A77 (= A78), T104 (= T105), G105 (= G106), R125 (= R126), I151 (= I152), G267 (≠ P277), D268 (≠ S278), E284 (= E291), T285 (≠ A292), W286 (= W293), A289 (= A296), W315 (= W321)
8pxkA Structure of nadh-dependent ferredoxin reductase, bpha4, solved at wavelength 5.76 a (see paper)
42% identity, 99% coverage: 4:409/409 of query aligns to 7:402/403 of 8pxkA
- binding flavin-adenine dinucleotide: G13 (= G10), A15 (≠ C12), D37 (≠ A34), E38 (= E35), R45 (= R42), P46 (= P43), K50 (= K47), A79 (= A78), T106 (= T105), G107 (= G106), R127 (= R126), I153 (= I152), G269 (≠ P277), D270 (≠ S278), E286 (= E291), T287 (≠ A292), W288 (= W293), A291 (= A296), W317 (= W321)
4h4uA Crystal structure of ferredoxin reductase, bpha4 t176r mutant (reduced form)
42% identity, 99% coverage: 4:409/409 of query aligns to 6:401/401 of 4h4uA
- active site: L13 (≠ E11), R44 (= R42), P45 (= P43), Q291 (= Q297)
- binding flavin-adenine dinucleotide: G12 (= G10), A14 (≠ C12), D36 (≠ A34), R44 (= R42), P45 (= P43), A78 (= A78), T105 (= T105), G106 (= G106), L125 (= L125), R126 (= R126), I152 (= I152), E155 (= E155), G268 (≠ P277), D269 (≠ S278), E285 (= E291), T286 (≠ A292), W287 (= W293), A290 (= A296), W316 (= W321)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V151 (≠ F151), I152 (= I152), E171 (= E171), R172 (≠ G172), Q173 (≠ L173), G230 (= G234), I231 (= I235), G232 (= G236), I284 (≠ L290), E285 (= E291), Y315 (≠ F320)
4h4wA Crystal structure of ferredoxin reductase, bpha4 e175c/t176r/q177g mutant (reduced form)
41% identity, 99% coverage: 4:408/409 of query aligns to 5:399/399 of 4h4wA
- active site: L12 (≠ E11), R43 (= R42), P44 (= P43), Q290 (= Q297)
- binding flavin-adenine dinucleotide: G11 (= G10), A13 (≠ C12), D35 (≠ A34), R43 (= R42), P44 (= P43), A77 (= A78), T104 (= T105), G105 (= G106), R125 (= R126), I151 (= I152), E154 (= E155), G267 (≠ P277), D268 (≠ S278), T285 (≠ A292), W286 (= W293), A289 (= A296), W315 (= W321)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G148 (= G149), I151 (= I152), R171 (≠ G172), S177 (= S178), R178 (= R179), G229 (= G234), I230 (= I235), G231 (= G236)
1q1wA Crystal structure of putidaredoxin reductase from pseudomonas putida (see paper)
37% identity, 100% coverage: 3:409/409 of query aligns to 5:413/422 of 1q1wA
- active site: L13 (≠ E11), L44 (≠ R42), P45 (= P43), L305 (≠ Q297)
- binding flavin-adenine dinucleotide: G10 (= G8), G12 (= G10), L13 (≠ E11), A14 (≠ C12), G35 (= G33), D36 (≠ A34), L44 (≠ R42), P45 (= P43), K49 (= K47), V82 (≠ A78), A108 (= A104), T109 (= T105), G110 (= G106), R133 (= R126), I159 (= I152), D283 (≠ A275), S300 (≠ A292), V301 (≠ W293), W329 (= W321)
P16640 Putidaredoxin reductase CamA; Pdr; Putidaredoxin--NAD(+) reductase; EC 1.18.1.5 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
37% identity, 100% coverage: 3:409/409 of query aligns to 6:414/422 of P16640
- A15 (≠ C12) binding
- D37 (≠ A34) binding
- K50 (= K47) binding
- V83 (≠ A78) binding
- R134 (= R126) binding
- D284 (≠ A275) binding
- V302 (≠ W293) binding
3lxdA Crystal structure of ferredoxin reductase arr from novosphingobium aromaticivorans (see paper)
36% identity, 99% coverage: 4:408/409 of query aligns to 6:409/409 of 3lxdA
- active site: H13 (≠ E11), R44 (= R42), P45 (= P43), N302 (≠ Q297)
- binding flavin-adenine dinucleotide: V9 (≠ I7), G10 (= G8), G12 (= G10), H13 (≠ E11), G14 (≠ C12), R36 (≠ A34), E37 (= E35), R44 (= R42), P45 (= P43), S48 (= S46), K49 (= K47), E81 (≠ T77), V82 (≠ A78), T109 (= T105), I157 (= I152), G278 (≠ A273), D279 (≠ T274), S297 (≠ A292), V298 (≠ W293), F325 (= F320), W326 (= W321)
3fg2P Crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris (see paper)
37% identity, 89% coverage: 4:369/409 of query aligns to 4:369/404 of 3fg2P
- binding flavin-adenine dinucleotide: G8 (= G8), G10 (= G10), H11 (≠ E11), A12 (≠ C12), D34 (≠ A34), E35 (= E35), R42 (= R42), P43 (= P43), S46 (= S46), K47 (= K47), R78 (≠ T77), M79 (≠ A78), T106 (= T105), R127 (= R126), I153 (= I152), D275 (≠ T274), S292 (≠ A292), V293 (≠ W293), W321 (= W321)
4emjA Complex between the reductase and ferredoxin components of toluene dioxygenase (see paper)
36% identity, 100% coverage: 2:409/409 of query aligns to 3:404/406 of 4emjA
- binding flavin-adenine dinucleotide: G11 (= G10), V12 (≠ E11), G13 (≠ C12), D35 (≠ A34), E36 (= E35), R43 (= R42), P44 (= P43), S47 (= S46), K48 (= K47), V80 (≠ A78), T107 (= T105), G108 (= G106), R128 (= R126), G274 (≠ T274), D275 (≠ A275), T291 (≠ A292), Y292 (≠ W293), S319 (≠ F320), W320 (= W321)
4emiA Toluene dioxygenase reductase in reduced state in complex with NAD+ (see paper)
36% identity, 99% coverage: 2:407/409 of query aligns to 2:401/402 of 4emiA
- binding flavin-adenine dinucleotide: G10 (= G10), V11 (≠ E11), G12 (≠ C12), D34 (≠ A34), E35 (= E35), R42 (= R42), P43 (= P43), K47 (= K47), E78 (≠ T77), V79 (≠ A78), T106 (= T105), G107 (= G106), G273 (≠ T274), D274 (≠ A275), T290 (≠ A292), Y291 (≠ W293), W319 (= W321)
- binding nicotinamide-adenine-dinucleotide: R111 (= R110), G149 (= G148), L152 (≠ F151), I153 (= I152), E156 (= E155), E172 (= E171), A173 (≠ G172), R180 (= R175), V236 (≠ I235), G237 (= G236), A238 (= A237), E289 (= E291), W319 (= W321), T320 (≠ S322)
6tukB Crystal structure of fdr9 (see paper)
32% identity, 99% coverage: 1:403/409 of query aligns to 1:390/393 of 6tukB
- binding flavin-adenine dinucleotide: V7 (≠ I7), G8 (= G8), G9 (≠ A9), G10 (= G10), A12 (≠ C12), A34 (= A34), E35 (= E35), R42 (= R42), P43 (= P43), K47 (= K47), A75 (≠ T77), A76 (= A78), T102 (= T105), G103 (= G106), V118 (≠ L125), R119 (= R126), G259 (≠ A273), D260 (≠ T274), H277 (≠ A292), W278 (= W293), F311 (= F320), W312 (= W321)
8d3gA Crystal structure of human apoptosis-inducing factor (aif) w196a mutant complexed with 6-chloroquinolin-4-amine
30% identity, 92% coverage: 19:394/409 of query aligns to 22:415/431 of 8d3gA
- binding flavin-adenine dinucleotide: E37 (≠ A34), D38 (≠ E35), R45 (= R42), P46 (= P43), K50 (= K47), K102 (≠ T77), V103 (≠ A78), T130 (= T105), G131 (= G106), F154 (≠ L125), R155 (= R126), G307 (≠ T274), D308 (≠ A275), H324 (≠ A292), H325 (≠ W293), A328 (= A296)
- binding 6-chloroquinolin-4-amine: F180 (= F151), L181 (≠ I152), E184 (= E155), H324 (≠ A292), F352 (= F320)
Sites not aligning to the query:
8d3oA Crystal structure of human apoptosis-inducing factor (aif) complexed with 8-methoxyquinolin-4-amine
29% identity, 92% coverage: 19:394/409 of query aligns to 23:422/436 of 8d3oA
- binding flavin-adenine dinucleotide: E38 (≠ A34), D39 (≠ E35), R46 (= R42), P47 (= P43), K51 (= K47), K104 (≠ T77), V105 (≠ A78), T132 (= T105), G133 (= G106), F156 (≠ L125), R157 (= R126), G309 (≠ T274), D310 (≠ A275), E325 (= E291), H326 (≠ A292), H327 (≠ W293), A330 (= A296)
- binding 8-methoxyquinolin-4-amine: F182 (= F151), L183 (≠ I152), E186 (= E155), E325 (= E291), H326 (≠ A292), F354 (= F320)
Sites not aligning to the query:
8d3kA Crystal structure of human apoptosis-inducing factor (aif) complexed with 8-fluoro-2-methylquinolin-4-amine
29% identity, 92% coverage: 19:394/409 of query aligns to 23:423/437 of 8d3kA
- binding flavin-adenine dinucleotide: E38 (≠ A34), D39 (≠ E35), R46 (= R42), P47 (= P43), K51 (= K47), K104 (≠ T77), V105 (≠ A78), T132 (= T105), F156 (≠ L125), R157 (= R126), G309 (≠ T274), D310 (≠ A275), E325 (= E291), H326 (≠ A292), H327 (≠ W293), A330 (= A296), W355 (= W321)
- binding 8-fluoro-2-methylquinolin-4-amine: F182 (= F151), L183 (≠ I152), E186 (= E155), H326 (≠ A292), F354 (= F320), W355 (= W321), S356 (= S322)
Sites not aligning to the query:
8d3hA Crystal structure of human apoptosis-inducing factor (aif) w196a mutant complexed with 7-chloroquinolin-4-amine
29% identity, 92% coverage: 19:394/409 of query aligns to 21:422/432 of 8d3hA
- binding flavin-adenine dinucleotide: E36 (≠ A34), D37 (≠ E35), R44 (= R42), P45 (= P43), S48 (= S46), K49 (= K47), K104 (≠ T77), V105 (≠ A78), T132 (= T105), G133 (= G106), F156 (≠ L125), R157 (= R126), G309 (≠ T274), D310 (≠ A275), H326 (≠ A292), H327 (≠ W293), A330 (= A296), W355 (= W321)
- binding 7-chloroquinolin-4-amine: F182 (= F151), L183 (≠ I152), E186 (= E155), W355 (= W321)
Sites not aligning to the query:
8d3eA Crystal structure of human apoptosis-inducing factor (aif) w196a mutant complexed with 6-fluoroquinolin-4-amine
29% identity, 92% coverage: 19:394/409 of query aligns to 22:423/433 of 8d3eA
- binding flavin-adenine dinucleotide: E37 (≠ A34), D38 (≠ E35), R45 (= R42), P46 (= P43), K50 (= K47), K105 (≠ T77), V106 (≠ A78), T133 (= T105), F157 (≠ L125), R158 (= R126), G310 (≠ T274), D311 (≠ A275), E326 (= E291), H327 (≠ A292), H328 (≠ W293), A331 (= A296), W356 (= W321)
- binding 6-fluoroquinolin-4-amine: F183 (= F151), L184 (≠ I152), E187 (= E155), E326 (= E291), H327 (≠ A292), F355 (= F320)
Sites not aligning to the query:
8d3jA Crystal structure of human apoptosis-inducing factor (aif) complexed with 6-fluoro-2-methylquinolin-4-amine
30% identity, 79% coverage: 19:342/409 of query aligns to 23:376/436 of 8d3jA
- binding flavin-adenine dinucleotide: E38 (≠ A34), D39 (≠ E35), R46 (= R42), P47 (= P43), K51 (= K47), K103 (≠ T77), V104 (≠ A78), T131 (= T105), F155 (≠ L125), R156 (= R126), G308 (≠ T274), D309 (≠ A275), E324 (= E291), H325 (≠ A292), H326 (≠ W293), W354 (= W321)
- binding 6-fluoro-2-methylquinolin-4-amine: F181 (= F151), L182 (≠ I152), E185 (= E155), H325 (≠ A292), F353 (= F320), W354 (= W321), S355 (= S322)
Sites not aligning to the query:
Query Sequence
>SM_b20820 FitnessBrowser__Smeli:SM_b20820
MTHIVIIGAGECGARAAFALREKGFGGEITLTGAEPHLPYERPPLSKDGLAQASLPKFIA
GAARYEEARITVLTGVTAESIDRVHKAVTLSDGVSLDYDRLLLATGARPRAFPRVPENAG
RIRTLRTHADALAIRGALTPGARLAVIGGGFIGLELAATARKLGAEVVLVEGLPRVLSRG
VPEEIAVLVAERHRREGVEIICGAQIAAIDGAGDGARLLLADGVDIEADLIVVGIGAVPN
TELAEAAGLAIENGIAVDERLCTSDPRHLCRPATAAPSLCPHYGGRRVRLEAWRNAQDQG
ALAAANLMGAGETMVSVPWFWSDQYEFTLQIAGLADGAETTVRRDMEEGAFILFHLDGEG
RLIAASGIGPGNAVARDIRLAEMLIAAGAKPEPLALASPETRLKKLLAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory