Comparing SM_b20855 FitnessBrowser__Smeli:SM_b20855 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
41% identity, 96% coverage: 5:487/504 of query aligns to 4:488/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 42% coverage: 5:217/504 of query aligns to 2:215/241 of 4u00A
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 42% coverage: 8:217/504 of query aligns to 6:220/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 42% coverage: 8:217/504 of query aligns to 6:220/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 42% coverage: 8:217/504 of query aligns to 6:220/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
32% identity, 42% coverage: 8:217/504 of query aligns to 6:220/353 of Q97UY8
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 42% coverage: 4:217/504 of query aligns to 2:217/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 42% coverage: 4:217/504 of query aligns to 2:217/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
28% identity, 42% coverage: 4:217/504 of query aligns to 2:217/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
28% identity, 42% coverage: 4:217/504 of query aligns to 2:217/242 of 2oljA
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 43% coverage: 4:218/504 of query aligns to 3:230/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 43% coverage: 4:218/504 of query aligns to 3:230/253 of 1g9xB
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
31% identity, 43% coverage: 8:226/504 of query aligns to 6:230/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
31% identity, 43% coverage: 8:226/504 of query aligns to 6:230/592 of 5lj7A
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
29% identity, 43% coverage: 4:221/504 of query aligns to 2:221/223 of 2pclA
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
26% identity, 46% coverage: 8:239/504 of query aligns to 14:249/265 of P07821
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
32% identity, 43% coverage: 7:225/504 of query aligns to 5:225/350 of 3fvqB
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
27% identity, 46% coverage: 8:239/504 of query aligns to 7:231/285 of 4yerA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 40% coverage: 11:214/504 of query aligns to 7:212/240 of 4ymuJ
7arlD Lolcde in complex with lipoprotein and adp (see paper)
32% identity, 38% coverage: 21:214/504 of query aligns to 22:218/222 of 7arlD
>SM_b20855 FitnessBrowser__Smeli:SM_b20855
MVTELANLKSISKSFGGIHALRSVNFDVRPGEVHALLGENGAGKSTLMRVLGGEIIPSQG
EVVINGKRTELRDPRDARALGIVVIHQELALAPDLSVAENIFLGELPTLISRFSLRRRAK
QLIDRLGFDIDPGRLVGTLSVAHQQVVEIAKALSQDIKIIVFDEPTAVLGAQDAMKLHQI
IRGLRDRGVGIVYISHRLDEVFDIADRMTVMKDGETVGTVATTDVKIDDIIRMMVGRPIA
NMFPERSQRTIGAELLNVKKLNAGRMVRDVSFSVRAGEIVGLGGLIGSGRTEVARAIFGA
DPLDSGTISLKGKALKLKSPRDAVKAGIGLVPEDRKEHGVVIDKPIRVNATMARMSSVVN
ALGFLKPALERTDVTALGKSLRLKASSIDAPVSSLSGGNQQKVVLAKWFHAGGDVIILDE
PTRGVDVGAKAEIYALINKLAEDGKAVLVISSEHQELFGLCDRVLAMGQGQIRGELTPSN
YSEENLLGLSMMGGARASNQGSQV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory