Comparing SM_b20856 FitnessBrowser__Smeli:SM_b20856 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
62% identity, 92% coverage: 27:322/322 of query aligns to 3:297/297 of 4ry9B
4ry9A Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
62% identity, 92% coverage: 27:322/322 of query aligns to 3:297/297 of 4ry9A
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
33% identity, 89% coverage: 28:315/322 of query aligns to 3:286/292 of 2fn8A
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
32% identity, 88% coverage: 29:312/322 of query aligns to 3:273/274 of 2ioyA
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
31% identity, 84% coverage: 29:297/322 of query aligns to 4:262/271 of 1dbpA
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
29% identity, 82% coverage: 29:291/322 of query aligns to 5:255/270 of 4zjpA
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
30% identity, 89% coverage: 29:315/322 of query aligns to 9:283/287 of 4yo7A
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
27% identity, 91% coverage: 23:315/322 of query aligns to 5:282/284 of 7e7mC
4irxA Crystal structure of caulobacter myo-inositol binding protein bound to myo-inositol (see paper)
29% identity, 81% coverage: 21:281/322 of query aligns to 3:259/296 of 4irxA
4rxmB Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
29% identity, 91% coverage: 26:317/322 of query aligns to 2:284/288 of 4rxmB
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
27% identity, 83% coverage: 28:294/322 of query aligns to 4:270/287 of 5dteB
4rxmA Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
29% identity, 91% coverage: 26:317/322 of query aligns to 4:286/291 of 4rxmA
6hyhA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-fucofuranose (see paper)
28% identity, 75% coverage: 52:291/322 of query aligns to 27:264/304 of 6hyhA
Sites not aligning to the query:
6hbmA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with alpha-l-arabinofuranose (see paper)
28% identity, 75% coverage: 52:291/322 of query aligns to 27:264/304 of 6hbmA
Sites not aligning to the query:
6hbdA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-galactofuranose (see paper)
28% identity, 75% coverage: 52:291/322 of query aligns to 28:265/305 of 6hbdA
Sites not aligning to the query:
P0AEE5 D-galactose/methyl-galactoside binding periplasmic protein MglB; D-galactose-binding periplasmic protein; GBP; D-galactose/D-glucose-binding protein; GGBP from Escherichia coli (strain K12) (see 4 papers)
28% identity, 89% coverage: 8:295/322 of query aligns to 7:303/332 of P0AEE5
Sites not aligning to the query:
P23905 D-galactose/methyl-galactoside binding periplasmic protein MglB; D-galactose-binding periplasmic protein; GBP; D-galactose/D-glucose-binding protein; GGBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
28% identity, 89% coverage: 8:295/322 of query aligns to 7:303/332 of P23905
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
29% identity, 76% coverage: 39:282/322 of query aligns to 15:249/287 of 5ibqA
Sites not aligning to the query:
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
29% identity, 76% coverage: 39:282/322 of query aligns to 15:249/287 of 4ry0A
Sites not aligning to the query:
5kwsA Crystal structure of galactose binding protein from yersinia pestis in the complex with beta d glucose
27% identity, 81% coverage: 25:284/322 of query aligns to 1:269/307 of 5kwsA
>SM_b20856 FitnessBrowser__Smeli:SM_b20856
MKKSIAGCMLALMASVASAGIANAADCKVGIAMYTLGAPYFAAQVAAAEDQAKKAGCEVT
SADGQNDMTKQIADVEDMVARGVNLLILNPRDPEGLVAAADAATAAGVKVVVMDSSINTK
ANVVTQVRSSNDQNGVLVGQWLANAMKGKPMKIILLSGDKGNEVGRDRRLGVFKGLVEGQ
LVNDGKVSFEVVGQGWGGWAHEGGLAAMEDLLTAHPDANVVLGENDSMVLGAMKALEAQG
KTDVLALAAADGQKEALALIKEGKYGATGLNDPDLVARTAVDVGLKAVNGELPADFPKLN
LTTPAVITKENVDKYYRADAVF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory