Comparing SM_b20894 FitnessBrowser__Smeli:SM_b20894 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
40% identity, 93% coverage: 26:498/506 of query aligns to 30:490/501 of P04983
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
30% identity, 44% coverage: 256:479/506 of query aligns to 3:218/226 of 5xu1B
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
24% identity, 43% coverage: 269:484/506 of query aligns to 12:217/240 of 6mjpA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
28% identity, 37% coverage: 33:217/506 of query aligns to 35:214/241 of 4u00A
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 37% coverage: 33:217/506 of query aligns to 36:216/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 37% coverage: 33:217/506 of query aligns to 36:216/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 37% coverage: 33:217/506 of query aligns to 36:216/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 37% coverage: 33:217/506 of query aligns to 36:216/242 of 2oljA
Sites not aligning to the query:
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
27% identity, 44% coverage: 269:493/506 of query aligns to 12:226/233 of 6b8bA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
27% identity, 44% coverage: 269:493/506 of query aligns to 12:226/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
27% identity, 44% coverage: 269:493/506 of query aligns to 12:226/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
27% identity, 44% coverage: 269:493/506 of query aligns to 12:226/235 of 6mhzA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
27% identity, 44% coverage: 269:493/506 of query aligns to 12:226/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
27% identity, 44% coverage: 269:493/506 of query aligns to 12:226/234 of 4p31A
Q9H172 ATP-binding cassette sub-family G member 4; EC 7.6.2.- from Homo sapiens (Human) (see 2 papers)
25% identity, 42% coverage: 272:482/506 of query aligns to 82:280/646 of Q9H172
6mbnA Lptb e163q in complex with atp (see paper)
26% identity, 44% coverage: 269:493/506 of query aligns to 13:227/241 of 6mbnA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
26% identity, 45% coverage: 263:489/506 of query aligns to 5:222/240 of 4ymuJ
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 44% coverage: 264:484/506 of query aligns to 10:222/343 of P30750
Sites not aligning to the query:
Q9H221 ATP-binding cassette sub-family G member 8; Sterolin-2; EC 7.6.2.- from Homo sapiens (Human) (see 7 papers)
27% identity, 41% coverage: 275:479/506 of query aligns to 88:289/673 of Q9H221
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
28% identity, 44% coverage: 264:484/506 of query aligns to 11:223/344 of 3tuzC
Sites not aligning to the query:
>SM_b20894 FitnessBrowser__Smeli:SM_b20894
MKCGALRRRFRASRPWTMSRSRSAKARSTRLSGKTAPAKSTLMKVLSGVYPAGTYEGEIH
YDGELRQFSTISDSEELGIIIIHQELALVPLLSIAENIFLGNEVAEKGVIHWPQTFARTQ
ELLKKVGLNESPATLITDIGVGKQQLVEIAKALSKKVRLLILDEPTASLNENDSDALLKL
LMEFRSQGMTSIIISHKLNEIKKVADQITILRDGGTVETLDCHKEDISEDRIINGMVGRA
MEDRYPPREPKIGDTLLEVKNWNVYHQHHRDRQFLHDVSFKVRAGEVVGIAGLMGAGRTE
TAMSVFGKSWGHKITGEVTMHGRPVDVSTIPKAIKAGLAYVTEDRKQLGLVLINNIMHNT
TLANLHAVASNGVIDERKERKVAAEYRSKLRIRSHSIYQETVNLSGGNQQKVVLSKWLFT
NPEVLILDEPTRGIDIGAKYEIYTIINQLAAEGKGILMISSEMPELLGTCDRIYVMNEGR
MVAELSKEEASQESIMRAIMRSGEKH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory