SitesBLAST
Comparing SM_b20899 FitnessBrowser__Smeli:SM_b20899 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
31% identity, 95% coverage: 2:316/330 of query aligns to 2:329/340 of 4n54A
- active site: K96 (= K93), H183 (= H174)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (= R12), K96 (= K93), D156 (= D152), D179 (= D170), M180 (= M171), H183 (= H174), R238 (= R229), Y244 (= Y235)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (≠ L8), G9 (= G9), L10 (≠ A10), G11 (= G11), R12 (= R12), L13 (≠ I13), S35 (≠ D34), V36 (≠ A35), E40 (≠ A39), S73 (≠ T70), P74 (= P71), F77 (≠ T74), H78 (= H75), E95 (= E92), K96 (= K93), M125 (≠ N121), F167 (vs. gap), F284 (= F275)
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
28% identity, 96% coverage: 3:320/330 of query aligns to 5:331/342 of 3ceaA
- active site: K98 (= K93), H185 (= H174)
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), G13 (= G11), R14 (= R12), L15 (≠ I13), L38 (≠ A35), Q42 (≠ A39), V74 (≠ C69), A75 (≠ T70), P76 (= P71), T77 (= T72), F79 (≠ T74), H80 (= H75), M83 (≠ L78), E97 (= E92), K98 (= K93), M127 (≠ N121), F169 (vs. gap), H185 (= H174), F286 (= F275)
3nt5A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor and product inosose (see paper)
28% identity, 97% coverage: 1:320/330 of query aligns to 1:318/337 of 3nt5A
- active site: K97 (= K93), H176 (= H174)
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K97 (= K93), H155 (≠ S150), H176 (= H174), Y235 (= Y235)
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), G11 (= G11), A12 (≠ R12), I13 (= I13), D35 (= D34), V36 (≠ A35), S74 (≠ T70), W75 (≠ P71), G76 (≠ T72), E96 (= E92), K97 (= K93), Y280 (= Y283)
3nt4A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadh and inositol (see paper)
28% identity, 97% coverage: 1:320/330 of query aligns to 1:318/337 of 3nt4A
- active site: K97 (= K93), H176 (= H174)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: H155 (≠ S150), H176 (= H174), Y235 (= Y235), W272 (≠ F275)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G11), A12 (≠ R12), I13 (= I13), D35 (= D34), V36 (≠ A35), S74 (≠ T70), W75 (≠ P71), G76 (≠ T72), E96 (= E92), K97 (= K93), H176 (= H174)
3nt2B Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
28% identity, 97% coverage: 1:320/330 of query aligns to 1:318/337 of 3nt2B
- active site: K97 (= K93), H176 (= H174)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G9), G11 (= G11), A12 (≠ R12), D35 (= D34), V36 (≠ A35), S74 (≠ T70), W75 (≠ P71), A78 (≠ T74), K97 (= K93), W272 (≠ F275), Y280 (= Y283)
3nt2A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
28% identity, 97% coverage: 1:320/330 of query aligns to 1:318/337 of 3nt2A
- active site: K97 (= K93), H176 (= H174)
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), G11 (= G11), A12 (≠ R12), I13 (= I13), D35 (= D34), V36 (≠ A35), S74 (≠ T70), W75 (≠ P71), G76 (≠ T72), A78 (≠ T74), H79 (= H75), E96 (= E92), K97 (= K93), H176 (= H174), Y280 (= Y283)
4l8vA Crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor NADP (see paper)
28% identity, 97% coverage: 1:320/330 of query aligns to 1:318/337 of 4l8vA
- active site: K97 (= K93), H176 (= H174)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ R12), I13 (= I13), S74 (≠ T70), W75 (≠ P71), H79 (= H75), E96 (= E92), K97 (= K93), M126 (≠ N121), W272 (≠ F275), Y280 (= Y283)
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
29% identity, 97% coverage: 1:320/330 of query aligns to 1:317/336 of 3ec7A
- active site: K97 (= K93), H176 (= H174)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), M12 (≠ R12), I13 (= I13), D35 (= D34), I36 (≠ A35), R40 (≠ A39), T73 (≠ C69), A74 (≠ T70), S75 (≠ P71), N76 (≠ T72), H79 (= H75), E96 (= E92), K97 (= K93), M126 (≠ N121), W271 (≠ F275), Y279 (= Y283)
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
28% identity, 99% coverage: 3:329/330 of query aligns to 2:329/333 of 4koaA
- active site: K94 (= K93), H180 (= H174)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), A9 (= A10), S10 (≠ G11), T11 (≠ R12), I12 (= I13), S33 (≠ D34), S34 (≠ A35), R38 (≠ A39), T71 (= T70), N73 (≠ T72), H76 (= H75), K94 (= K93), Q160 (vs. gap)
8qc8D Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ (see paper)
27% identity, 73% coverage: 2:243/330 of query aligns to 1:249/339 of 8qc8D
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), H11 (≠ R12), M12 (≠ I13), D33 (= D34), P34 (≠ A35), T35 (≠ F36), S38 (≠ A39), A71 (≠ C69), S72 (≠ T70), P73 (= P71), N74 (≠ T72), H77 (= H75), E96 (= E92), K97 (= K93), E125 (≠ N121), K162 (≠ P157), V163 (= V158), W166 (vs. gap)
6a3iA Levoglucosan dehydrogenase, complex with nadh and levoglucosan (see paper)
28% identity, 99% coverage: 2:329/330 of query aligns to 2:369/372 of 6a3iA
- binding Levoglucosan: K103 (= K93), Y132 (≠ R122), Y160 (≠ M145), Q162 (≠ T147), R175 (≠ Y160), D188 (= D170), H192 (= H174)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F12 (≠ R12), M13 (≠ I13), E42 (≠ D34), A43 (= A35), P81 (= P71), N82 (≠ T72), L84 (≠ T74), H85 (= H75), E102 (= E92), K103 (= K93), W174 (≠ D159), R175 (≠ Y160)
8qc2A Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ and sulfoquinovose (sq) (see paper)
27% identity, 73% coverage: 2:243/330 of query aligns to 3:260/363 of 8qc2A
- binding nicotinamide-adenine-dinucleotide: G12 (= G11), H13 (≠ R12), M14 (≠ I13), D35 (= D34), P36 (≠ A35), T37 (≠ F36), S40 (≠ A39), A73 (≠ C69), S74 (≠ T70), P75 (= P71), N76 (≠ T72), H79 (= H75), E98 (= E92), K99 (= K93), E127 (≠ N121), K164 (≠ P157), V165 (= V158), W168 (vs. gap)
- binding sulfoquinovose: K99 (= K93), Y128 (≠ R122), R158 (= R151), F161 (≠ S154), L162 (≠ A155), K164 (≠ P157), E181 (≠ D170), H185 (= H174)
Sites not aligning to the query:
8qc8B Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ (see paper)
27% identity, 73% coverage: 2:243/330 of query aligns to 5:262/367 of 8qc8B
- binding nicotinamide-adenine-dinucleotide: H15 (≠ R12), M16 (≠ I13), D37 (= D34), P38 (≠ A35), T39 (≠ F36), S42 (≠ A39), A75 (≠ C69), S76 (≠ T70), P77 (= P71), N78 (≠ T72), H81 (= H75), E100 (= E92), K101 (= K93), E129 (≠ N121), K166 (≠ P157), V167 (= V158), W170 (vs. gap)
Sites not aligning to the query:
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
26% identity, 92% coverage: 27:329/330 of query aligns to 29:336/336 of 5a06A
- active site: K101 (= K93), Y186 (≠ H174)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S36 (≠ D34), G37 (≠ A35), T38 (≠ F36), K41 (≠ A39), Y59 (≠ V51), I77 (≠ C69), T78 (= T70), P79 (= P71), N80 (≠ T72), L82 (≠ T74), H83 (= H75), E100 (= E92), K101 (= K93), R129 (≠ N121), W168 (≠ P156), R169 (≠ P157), Y186 (≠ H174), Y264 (≠ Q253)
- binding sorbitol: D72 (= D64), H96 (≠ A88), K101 (= K93), R122 (≠ A114), R122 (≠ A114), L124 (= L116), F160 (≠ I148), R169 (≠ P157), D182 (= D170), Y186 (≠ H174), K287 (≠ T280), H296 (≠ S289), E299 (≠ A292), E306 (= E299), G310 (≠ S303), G311 (= G304)
Sites not aligning to the query:
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
26% identity, 92% coverage: 27:329/330 of query aligns to 28:335/335 of 5a05A
- active site: K100 (= K93), Y185 (≠ H174)
- binding beta-D-glucopyranose: K100 (= K93), F159 (≠ I148), D181 (= D170), Y185 (≠ H174)
- binding alpha-D-glucopyranose: P259 (≠ A249), S262 (≠ N252)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S35 (≠ D34), G36 (≠ A35), T37 (≠ F36), K40 (≠ A39), Y58 (≠ V51), I76 (≠ C69), T77 (= T70), P78 (= P71), N79 (≠ T72), L81 (≠ T74), H82 (= H75), E99 (= E92), K100 (= K93), R128 (≠ N121), W167 (≠ P156), R168 (≠ P157), Y185 (≠ H174), Y263 (≠ Q253)
Sites not aligning to the query:
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
26% identity, 92% coverage: 27:329/330 of query aligns to 28:335/335 of 5a04A
- active site: K100 (= K93), Y185 (≠ H174)
- binding beta-D-glucopyranose: K100 (= K93), F159 (≠ I148), R168 (≠ P157), D181 (= D170), Y185 (≠ H174)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S35 (≠ D34), G36 (≠ A35), T37 (≠ F36), K40 (≠ A39), Y58 (≠ V51), I76 (≠ C69), T77 (= T70), P78 (= P71), N79 (≠ T72), L81 (≠ T74), H82 (= H75), E99 (= E92), K100 (= K93), R128 (≠ N121), W167 (≠ P156), R168 (≠ P157), Y185 (≠ H174), Y263 (≠ Q253)
Sites not aligning to the query:
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
26% identity, 92% coverage: 27:329/330 of query aligns to 28:335/335 of 5a03E
- active site: K100 (= K93), Y185 (≠ H174)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S35 (≠ D34), G36 (≠ A35), T37 (≠ F36), K40 (≠ A39), Y58 (≠ V51), I76 (≠ C69), T77 (= T70), P78 (= P71), N79 (≠ T72), H82 (= H75), E99 (= E92), K100 (= K93), R128 (≠ N121), W167 (≠ P156), R168 (≠ P157), Y185 (≠ H174), Y263 (≠ Q253)
- binding beta-D-xylopyranose: K100 (= K93), F159 (≠ I148), R168 (≠ P157), D181 (= D170), Y185 (≠ H174), E205 (≠ A194), T207 (≠ V196), R209 (≠ L197)
- binding alpha-D-xylopyranose: H134 (= H127), M268 (≠ I258), R279 (≠ D273), E280 (≠ F274)
Sites not aligning to the query:
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
26% identity, 92% coverage: 27:329/330 of query aligns to 29:336/336 of 5a03C
- active site: K101 (= K93), Y186 (≠ H174)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S36 (≠ D34), G37 (≠ A35), T38 (≠ F36), K41 (≠ A39), Y59 (≠ V51), I77 (≠ C69), T78 (= T70), P79 (= P71), N80 (≠ T72), L82 (≠ T74), H83 (= H75), E100 (= E92), K101 (= K93), R129 (≠ N121), W168 (≠ P156), R169 (≠ P157), Y186 (≠ H174), Y264 (≠ Q253)
- binding beta-D-xylopyranose: K101 (= K93), F160 (≠ I148), R169 (≠ P157), D182 (= D170), Y186 (≠ H174)
Sites not aligning to the query:
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
26% identity, 92% coverage: 27:329/330 of query aligns to 28:335/335 of 5a02A
- active site: K100 (= K93), Y185 (≠ H174)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S35 (≠ D34), G36 (≠ A35), T37 (≠ F36), K40 (≠ A39), Y58 (≠ V51), I76 (≠ C69), T77 (= T70), P78 (= P71), L81 (≠ T74), H82 (= H75), E99 (= E92), K100 (= K93), R128 (≠ N121), W167 (≠ P156), R168 (≠ P157), Y185 (≠ H174), Y263 (≠ Q253)
Sites not aligning to the query:
6a3jC Levoglucosan dehydrogenase, complex with nadh and l-sorbose (see paper)
27% identity, 99% coverage: 2:329/330 of query aligns to 1:373/378 of 6a3jC
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G11), F11 (≠ R12), M12 (≠ I13), E41 (≠ D34), T79 (= T70), P80 (= P71), N81 (≠ T72), H84 (= H75), E101 (= E92), K102 (= K93), W173 (≠ D159), R174 (≠ Y160)
- binding alpha-L-sorbopyranose: K102 (= K93), Y131 (≠ R122), Y159 (≠ M145), Q161 (≠ T147), W163 (≠ T149), R174 (≠ Y160), D187 (= D170)
Query Sequence
>SM_b20899 FitnessBrowser__Smeli:SM_b20899
MTVRFGLLGAGRIGKVHAKAVSGNADARLVAVADAFPAAAEAIAGAYGCEVRTIDAIEAA
ADIDAVVICTPTDTHADLIERFARAGKAIFCEKPIDLDAERVRACLKVVSDTKAKLMVGF
NRRFDPHFMAVRKAIDDGRIGEVEMVTITSRDPSAPPVDYIKRSGGIFRDMTIHDFDMAR
FLLGEEPVSVTATAAVLIDKAIGDAGDYDSVSVILQTASGKQAIISNSRRATYGYDQRIE
VHGSKGAVAAENQRPVSIEIATGDGYTRPPLHDFFMTRYTEAYANEIESFIAAIEKGAEI
APSGNDGLAALALADAAVRSVAEKRQISIA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory