SitesBLAST
Comparing SM_b20942 FitnessBrowser__Smeli:SM_b20942 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4twrA Structure of udp-glucose 4-epimerase from brucella abortus
53% identity, 96% coverage: 4:317/328 of query aligns to 2:316/325 of 4twrA
- active site: S117 (≠ T119), C118 (= C120), A119 (= A121), Y141 (= Y143), K145 (= K147), H184 (= H186), H189 (= H191)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), F12 (≠ Y14), I13 (= I15), D32 (= D34), N33 (= N35), L34 (= L36), S35 (= S37), T36 (≠ N38), G37 (= G39), D51 (= D53), I52 (= I54), F73 (= F75), A74 (= A76), A75 (= A77), N92 (= N94), S115 (= S117), K145 (= K147), Y168 (= Y170), A171 (= A173), H184 (= H186)
- binding zinc ion: E182 (= E184), H184 (= H186), E187 (= E189), H189 (= H191)
2c20A Crystal structure of udp-glucose 4-epimerase
47% identity, 99% coverage: 4:327/328 of query aligns to 1:326/329 of 2c20A
- active site: T117 (= T119), A118 (≠ C120), A119 (= A121), Y141 (= Y143), K145 (= K147), H184 (= H186)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), Q34 (≠ S37), T35 (≠ N38), G36 (= G39), D51 (= D53), L52 (≠ I54), F73 (= F75), A74 (= A76), A75 (= A77), N92 (= N94), Y141 (= Y143), K145 (= K147), Y168 (= Y170), F169 (= F171), V171 (≠ A173), H184 (= H186)
- binding zinc ion: E182 (= E184), H184 (= H186), E187 (= E189), H189 (= H191)
7k3pA The structure of the udp-glc/glcnac 4-epimerase from the human pathogen campylobacter jejuni
41% identity, 98% coverage: 4:323/328 of query aligns to 2:328/329 of 7k3pA
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (= Y14), I13 (= I15), D32 (= D34), N33 (= N35), S35 (= S37), G37 (= G39), D57 (= D53), L58 (≠ I54), F79 (= F75), A80 (= A76), I83 (= I79), N98 (= N94), Y147 (= Y143), K151 (= K147), Y175 (= Y170), N177 (= N172), V178 (≠ A173)
1gy8C Trypanosoma brucei udp-galactose 4' epimerase (see paper)
40% identity, 98% coverage: 6:327/328 of query aligns to 5:368/370 of 1gy8C
- active site: S144 (≠ T119), A145 (≠ C120), A146 (= A121), Y170 (= Y143), K174 (= K147)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), G12 (= G13), Y13 (= Y14), I14 (= I15), D34 (= D34), S35 (≠ N35), L36 (= L36), V37 (vs. gap), G38 (vs. gap), D77 (= D53), V78 (≠ I54), M100 (≠ F75), C101 (≠ A76), A102 (= A77), L104 (≠ I79), N119 (= N94), S142 (= S117), S143 (= S118), S144 (≠ T119), Y170 (= Y143), K174 (= K147), Y197 (= Y170), A200 (= A173)
- binding uridine-5'-diphosphate: N199 (= N172), H218 (= H191), L219 (≠ A192), I222 (vs. gap), M241 (≠ F207), P242 (≠ K208), I243 (≠ V209), F244 (= F210), C255 (= C221), R257 (= R223), R324 (= R284), D327 (= D287)
7xpoA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glc (see paper)
41% identity, 98% coverage: 5:327/328 of query aligns to 3:341/344 of 7xpoA
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (= Y14), I13 (= I15), D32 (= D34), N33 (= N35), N36 (= N38), D62 (= D53), L63 (≠ I54), F84 (= F75), A85 (= A76), G86 (≠ A77), K88 (≠ I79), N103 (= N94), S126 (= S117), S128 (≠ T119), Y152 (= Y143), K156 (= K147), Y180 (= Y170), P183 (≠ A173)
- binding uridine-5'-diphosphate-glucose: S128 (≠ T119), A129 (≠ C120), F181 (= F171), N182 (= N172), N202 (≠ H191), L203 (≠ A192), T219 (≠ K208), V220 (= V209), Y221 (≠ F210), R234 (= R223), Y236 (= Y225), V275 (= V261), R298 (= R284), D301 (= D287)
7xpqA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glcnac (see paper)
41% identity, 98% coverage: 5:327/328 of query aligns to 3:341/343 of 7xpqA
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (= Y14), I13 (= I15), D32 (= D34), N33 (= N35), N36 (= N38), D62 (= D53), L63 (≠ I54), F84 (= F75), A85 (= A76), G86 (≠ A77), K88 (≠ I79), N103 (= N94), S126 (= S117), S128 (≠ T119), Y152 (= Y143), K156 (= K147), Y180 (= Y170), P183 (≠ A173)
- binding uridine-diphosphate-n-acetylglucosamine: N182 (= N172), N202 (≠ H191), L203 (≠ A192), T219 (≠ K208), Y221 (≠ F210), R234 (= R223), Y236 (= Y225), V275 (= V261), R298 (= R284), D301 (= D287)
2cnbA Trypanosoma brucei udp-galactose-4-epimerase in ternary complex with NAD and the substrate analogue udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
39% identity, 98% coverage: 6:327/328 of query aligns to 5:364/366 of 2cnbA
- active site: S144 (≠ T119), A145 (≠ C120), A146 (= A121), Y169 (= Y143), K173 (= K147)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), G12 (= G13), Y13 (= Y14), I14 (= I15), D34 (= D34), S35 (≠ N35), V37 (vs. gap), G38 (vs. gap), D77 (= D53), V78 (≠ I54), M100 (≠ F75), C101 (≠ A76), A102 (= A77), L104 (≠ I79), N119 (= N94), S143 (= S118), S144 (≠ T119), Y169 (= Y143), K173 (= K147), Y196 (= Y170), F197 (= F171), A199 (= A173)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: L104 (≠ I79), S144 (≠ T119), Y169 (= Y143), F197 (= F171), N198 (= N172), H217 (= H191), L218 (≠ A192), P238 (≠ K208), I239 (≠ V209), F240 (= F210), C251 (= C221), R253 (= R223), V297 (= V261), R320 (= R284), D323 (= D287)
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
40% identity, 98% coverage: 6:327/328 of query aligns to 3:335/338 of 2udpA
- active site: S124 (≠ T119), A125 (≠ C120), T126 (≠ A121), Y149 (= Y143), K153 (= K147), M189 (≠ I182)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), L33 (= L36), C34 (≠ S37), N35 (= N38), S36 (≠ G39), D58 (= D53), I59 (= I54), F80 (= F75), A81 (= A76), G82 (≠ A77), K84 (≠ I79), S122 (= S117), S124 (≠ T119), Y149 (= Y143), K153 (= K147), Y177 (= Y170)
- binding phenyl-uridine-5'-diphosphate: N179 (= N172), N199 (≠ H191), L200 (≠ A192), A216 (≠ K208), I217 (≠ V209), F218 (= F210), R231 (= R223), Y233 (= Y225), V269 (= V261), R292 (= R284), D295 (= D287)
1udcA Structure of udp-galactose-4-epimerase complexed with udp-mannose (see paper)
40% identity, 98% coverage: 6:327/328 of query aligns to 3:335/338 of 1udcA
- active site: S124 (≠ T119), A125 (≠ C120), T126 (≠ A121), Y149 (= Y143), K153 (= K147), M189 (≠ I182)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), C34 (≠ S37), N35 (= N38), S36 (≠ G39), D58 (= D53), I59 (= I54), F80 (= F75), A81 (= A76), G82 (≠ A77), K84 (≠ I79), S122 (= S117), Y149 (= Y143), K153 (= K147), Y177 (= Y170), P180 (≠ A173)
- binding uridine-5'-diphosphate-mannose: T126 (≠ A121), Y149 (= Y143), N179 (= N172), N199 (≠ H191), L200 (≠ A192), L215 (≠ F207), A216 (≠ K208), I217 (≠ V209), F218 (= F210), R231 (= R223), Y233 (= Y225), V269 (= V261), R292 (= R284)
P09147 UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 from Escherichia coli (strain K12) (see 10 papers)
40% identity, 98% coverage: 6:327/328 of query aligns to 3:335/338 of P09147
- YI 11:12 (= YI 14:15) binding
- DNLCNS 31:36 (≠ DNLSNG 34:39) binding
- DI 58:59 (= DI 53:54) binding
- FAGLK 80:84 (≠ FAAMI 75:79) binding
- N99 (= N94) binding
- S124 (≠ T119) binding ; mutation to A: No major structural changes. Catalytic efficiency is very low and affinity binding is 21% of the wild-type enzyme.; mutation to T: No major structural changes. Catalytic efficiency is about 30% of that of the wild-type enzyme, and affinity binding is similar to that of the native enzyme.
- Y149 (= Y143) active site, Proton acceptor; binding ; mutation to F: No major structural changes. Catalytic efficiency is very low and affinity binding is 12% of the wild-type enzyme.
- K153 (= K147) binding ; mutation to A: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.; mutation to M: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.
- F178 (= F171) binding
- Y299 (≠ L291) mutation to C: Loss of epimerase activity with UDP-Gal by almost 5-fold, but it results in a gain of epimerase activity with uridine diphosphate N-acetylglucosamine (UDP-GlcNAc) by 230-fold with minimal changes in its three-dimensional structure.
1udaA Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
40% identity, 98% coverage: 6:327/328 of query aligns to 3:335/338 of 1udaA
- active site: S124 (≠ T119), A125 (≠ C120), T126 (≠ A121), Y149 (= Y143), K153 (= K147), M189 (≠ I182)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), L33 (= L36), C34 (≠ S37), N35 (= N38), S36 (≠ G39), D58 (= D53), I59 (= I54), F80 (= F75), A81 (= A76), G82 (≠ A77), K84 (≠ I79), S122 (= S117), Y149 (= Y143), K153 (= K147), Y177 (= Y170), P180 (≠ A173)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: T126 (≠ A121), N179 (= N172), N199 (≠ H191), L200 (≠ A192), A216 (≠ K208), I217 (≠ V209), F218 (= F210), R231 (= R223), Y233 (= Y225), R292 (= R284), D295 (= D287), Y299 (≠ L291)
1naiA Udp-galactose 4-epimerase from escherichia coli, oxidized (see paper)
40% identity, 98% coverage: 6:327/328 of query aligns to 3:335/338 of 1naiA
- active site: S124 (≠ T119), A125 (≠ C120), T126 (≠ A121), Y149 (= Y143), K153 (= K147), M189 (≠ I182)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), L33 (= L36), C34 (≠ S37), N35 (= N38), S36 (≠ G39), D58 (= D53), I59 (= I54), F80 (= F75), A81 (= A76), G82 (≠ A77), K84 (≠ I79), Y149 (= Y143), K153 (= K147), Y177 (= Y170), P180 (≠ A173)
- binding 1,3-propandiol: N35 (= N38), K84 (≠ I79), E191 (= E184), P193 (= P188)
- binding uridine-5'-diphosphate: N179 (= N172), N199 (≠ H191), L200 (≠ A192), L215 (≠ F207), A216 (≠ K208), R231 (= R223), Y233 (= Y225), R292 (= R284)
1lrjA Crystal structure of e. Coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine (see paper)
40% identity, 98% coverage: 6:327/328 of query aligns to 3:335/338 of 1lrjA
- active site: S124 (≠ T119), A125 (≠ C120), T126 (≠ A121), Y149 (= Y143), K153 (= K147), M189 (≠ I182)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), L33 (= L36), C34 (≠ S37), N35 (= N38), S36 (≠ G39), D58 (= D53), I59 (= I54), F80 (= F75), A81 (= A76), G82 (≠ A77), K84 (≠ I79), Y149 (= Y143), K153 (= K147), Y177 (= Y170), P180 (≠ A173)
- binding uridine-diphosphate-n-acetylglucosamine: V86 (= V81), S124 (≠ T119), F178 (= F171), N179 (= N172), L200 (≠ A192), L215 (≠ F207), A216 (≠ K208), F218 (= F210), R231 (= R223), Y233 (= Y225), V269 (= V261), R292 (= R284), D295 (= D287)
1kvrA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
40% identity, 98% coverage: 6:327/328 of query aligns to 3:335/338 of 1kvrA
- active site: A124 (≠ T119), A125 (≠ C120), T126 (≠ A121), Y149 (= Y143), K153 (= K147), M189 (≠ I182)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), C34 (≠ S37), N35 (= N38), S36 (≠ G39), D58 (= D53), I59 (= I54), F80 (= F75), A81 (= A76), G82 (≠ A77), K84 (≠ I79), S122 (= S117), S123 (= S118), Y149 (= Y143), K153 (= K147), Y177 (= Y170), P180 (≠ A173)
- binding uridine-5'-diphosphate: N179 (= N172), N198 (≠ T190), N199 (≠ H191), L200 (≠ A192), A216 (≠ K208), I217 (≠ V209), F218 (= F210), R231 (= R223), Y233 (= Y225), V269 (= V261), R292 (= R284), D295 (= D287)
1a9yA Udp-galactose 4-epimerase mutant s124a/y149f complexed with udp- glucose (see paper)
40% identity, 98% coverage: 6:327/328 of query aligns to 3:335/338 of 1a9yA
- active site: A124 (≠ T119), A125 (≠ C120), T126 (≠ A121), F149 (≠ Y143), K153 (= K147)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), C34 (≠ S37), N35 (= N38), S36 (≠ G39), D58 (= D53), I59 (= I54), F80 (= F75), A81 (= A76), G82 (≠ A77), K84 (≠ I79), S122 (= S117), S123 (= S118), F149 (≠ Y143), K153 (= K147), Y177 (= Y170), P180 (≠ A173)
- binding uridine-5'-diphosphate-glucose: A125 (≠ C120), T126 (≠ A121), N179 (= N172), N199 (≠ H191), L200 (≠ A192), A216 (≠ K208), I217 (≠ V209), F218 (= F210), R231 (= R223), Y233 (= Y225), R292 (= R284), D295 (= D287), Y299 (≠ L291)
7kn1A Crystal structure of udp-glucose-4-epimerase (gale) from stenotrophomonas maltophila with bound NAD and formylated udp- arabinopyranose
41% identity, 97% coverage: 5:321/328 of query aligns to 4:330/336 of 7kn1A
- active site: S126 (≠ T119), Y150 (= Y143), K154 (= K147)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), G12 (= G13), Y13 (= Y14), I14 (= I15), D33 (= D34), S34 (≠ N35), C36 (≠ S37), N37 (= N38), D60 (= D53), I61 (= I54), F82 (= F75), A83 (= A76), A84 (= A77), K86 (≠ I79), S124 (= S117), S125 (= S118), S126 (≠ T119), Y150 (= Y143), K154 (= K147), Y178 (= Y170), P181 (≠ A173)
- binding UDP-4-deoxy-4-formamido-beta-L-arabinopyranose: V88 (= V81), S126 (≠ T119), Y150 (= Y143), N180 (= N172), S199 (≠ T190), N200 (≠ H191), L201 (≠ A192), Q217 (≠ K208), V218 (= V209), F219 (= F210), R232 (= R223), Y234 (= Y225), V270 (= V261), R293 (= R284), D296 (= D287)
1ek6A Structure of human udp-galactose 4-epimerase complexed with nadh and udp-glucose (see paper)
40% identity, 98% coverage: 5:327/328 of query aligns to 4:343/346 of 1ek6A
- active site: S132 (≠ T119), A133 (≠ C120), T134 (≠ A121), Y157 (= Y143), K161 (= K147)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G10), G12 (= G13), Y13 (= Y14), I14 (= I15), D33 (= D34), N34 (= N35), H36 (≠ S37), N37 (= N38), D66 (= D53), I67 (= I54), F88 (= F75), A89 (= A76), G90 (≠ A77), K92 (≠ I79), S130 (= S117), S131 (= S118), S132 (≠ T119), Y157 (= Y143), K161 (= K147), Y185 (= Y170), P188 (≠ A173)
- binding uridine-5'-diphosphate-glucose: S132 (≠ T119), Y157 (= Y143), F186 (= F171), N187 (= N172), N207 (≠ H191), L208 (≠ A192), N224 (≠ K208), V225 (= V209), F226 (= F210), R239 (= R223), Y241 (= Y225), V277 (= V261), R300 (= R284), D303 (= D287)
Q14376 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Homo sapiens (Human) (see 13 papers)
40% identity, 98% coverage: 5:327/328 of query aligns to 4:343/348 of Q14376
- GYI 12:14 (= GYI 13:15) binding
- DNFHN 33:37 (≠ DNLSN 34:38) binding
- N34 (= N35) to S: in GALAC3; peripheral; nearly normal activity towards UDP-galactose; dbSNP:rs121908046
- DI 66:67 (= DI 53:54) binding
- F88 (= F75) binding
- G90 (≠ A77) to E: in GALAC3; 800-fold decrease in UDP-galactose epimerization activity; dbSNP:rs28940882
- K92 (≠ I79) binding
- V94 (= V81) to M: in GALAC3; generalized; 30-fold decrease in UDP-galactose epimerization activity; 2-fold decrease in affinity for UDP-galactose; 24% of normal activity with respect to UDP-N-acetylgalactosamine; dbSNP:rs121908047
- D103 (≠ A90) to G: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs28940883
- S132 (≠ T119) mutation to A: Loss of activity.
- SAT 132:134 (≠ TCA 119:121) binding
- Y157 (= Y143) active site, Proton acceptor; mutation to F: Loss of activity.
- K161 (= K147) binding
- A180 (≠ S165) to V: in dbSNP:rs3204468
- L183 (= L168) to P: in GALAC3; peripheral; 3-fold decrease in UDP-galactose epimerization activity; dbSNP:rs121908045
- Y185 (= Y170) binding
- YFN 185:187 (= YFN 170:172) binding
- NNL 206:208 (≠ THA 190:192) binding
- NVF 224:226 (≠ KVF 208:210) binding
- R239 (= R223) binding
- K257 (≠ Y241) to R: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; does not affect affinity for UDP-galactose; dbSNP:rs28940884
- REGD 300:303 (= REGD 284:287) binding
- C307 (≠ L291) mutation to Y: No effect on activity towards UDP-galactose. Loss of activity towards UDP-N-acetylgalactosamine.
- L313 (≠ K297) to M: in GALAC3; 6-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs3180383
- G319 (= G303) to E: in GALAC3; nearly normal activity towards UDP-galactose; mild impairment under conditions of substrate limitation; dbSNP:rs28940885
- R335 (≠ N319) to H: in GALAC3; 2-fold decrease in UDP-galactose epimerization activity; dbSNP:rs368637540
Q9SA77 UDP-arabinose 4-epimerase 1; UDP-D-xylose 4-epimerase 1; EC 5.1.3.5 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 99% coverage: 4:327/328 of query aligns to 71:408/419 of Q9SA77
- G275 (≠ P194) mutation to D: In mur4-1; 50% reduction in L-Ara in cell wall material.
- R304 (= R223) mutation to Q: In mur4-3; 50% reduction in L-Ara in cell wall material.
1hzjA Human udp-galactose 4-epimerase: accommodation of udp-n- acetylglucosamine within the active site (see paper)
40% identity, 98% coverage: 5:327/328 of query aligns to 3:342/345 of 1hzjA
- active site: S131 (≠ T119), A132 (≠ C120), T133 (≠ A121), Y156 (= Y143), K160 (= K147)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (= Y14), I13 (= I15), D32 (= D34), N33 (= N35), H35 (≠ S37), N36 (= N38), D65 (= D53), I66 (= I54), F87 (= F75), A88 (= A76), G89 (≠ A77), K91 (≠ I79), S129 (= S117), S131 (≠ T119), Y156 (= Y143), K160 (= K147), Y184 (= Y170), P187 (≠ A173)
- binding uridine-diphosphate-n-acetylglucosamine: N186 (= N172), N206 (≠ H191), L207 (≠ A192), N223 (≠ K208), V224 (= V209), F225 (= F210), R238 (= R223), Y240 (= Y225), V276 (= V261), R299 (= R284), D302 (= D287)
Query Sequence
>SM_b20942 FitnessBrowser__Smeli:SM_b20942
MQNNNILVVGGAGYIGSHTCLQLAAKGYQPVVYDNLSNGHEEFVKWGVLEKGDIRDRQRL
DEVLARHKPRAILHFAAMIEVGESVKDPAAFYDNNVIGTLTLLSAALAAGIDAFVFSSTC
ATYGLPDSVPMDESHKQAPINPYGRTKWICEQALKDYGLYKGLRSVILRYFNAAGADFEG
RIGEWHEPETHAIPLAIDAALGRREGFKVFGTDYDTRDGTCVRDYIHVLDLADAHVRAVD
YLLEGGESVALNLGTGTGTTVKELLDAIEKVAKRPFNIGYAERREGDSTTLVANNDKARQ
VLGWEPQYDLAAITESAWNWHSRRNQGG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory