SitesBLAST
Comparing SM_b21010 FitnessBrowser__Smeli:SM_b21010 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5yssB Crystal structure of aminocaproic acid cyclase in complex with NAD (+) (see paper)
55% identity, 99% coverage: 3:258/258 of query aligns to 5:255/255 of 5yssB
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), T13 (= T11), S14 (= S12), G15 (= G13), I16 (= I14), G35 (= G33), F36 (= F34), L60 (≠ M62), N86 (= N88), G88 (= G90), I89 (≠ V91), A137 (= A139), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184), V184 (= V186), T186 (= T188)
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
55% identity, 99% coverage: 3:258/258 of query aligns to 5:260/260 of 2ztlA
- active site: G15 (= G13), N114 (= N112), S142 (= S140), Y155 (= Y153), K159 (= K157), L200 (≠ Q198)
- binding (3s)-3-hydroxybutanoic acid: Q94 (= Q92), S142 (= S140), H144 (= H142), K152 (= K150), Y155 (= Y153), Q196 (= Q194)
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), G15 (= G13), I16 (= I14), F36 (= F34), L64 (≠ M62), N90 (= N88), A91 (= A89), G92 (= G90), L113 (≠ V111), Y155 (= Y153), K159 (= K157), P185 (= P183), W187 (≠ Y185), V188 (= V186), T190 (= T188), V193 (= V191)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
55% identity, 99% coverage: 3:258/258 of query aligns to 5:260/260 of 1wmbA
5b4tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and a substrate d-3- hydroxybutyrate (see paper)
53% identity, 99% coverage: 3:258/258 of query aligns to 5:260/260 of 5b4tA
- active site: G15 (= G13), N114 (= N112), S142 (= S140), Y155 (= Y153), K159 (= K157), I200 (≠ Q198)
- binding (3R)-3-hydroxybutanoic acid: Q94 (= Q92), S142 (= S140), H144 (= H142), K152 (= K150), Y155 (= Y153), W187 (≠ Y185), Q196 (= Q194)
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), T13 (= T11), G15 (= G13), I16 (= I14), F36 (= F34), D63 (= D61), L64 (≠ M62), N90 (= N88), G92 (= G90), L113 (≠ V111), I140 (= I138), Y155 (= Y153), K159 (= K157), P185 (= P183), G186 (= G184), W187 (≠ Y185), V188 (= V186), T190 (= T188), L192 (= L190), V193 (= V191)
3w8dA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and an inhibitor methylmalonate
53% identity, 99% coverage: 3:258/258 of query aligns to 5:260/260 of 3w8dA
- active site: G15 (= G13), N114 (= N112), S142 (= S140), Y155 (= Y153), K159 (= K157), I200 (≠ Q198)
- binding methylmalonic acid: Q94 (= Q92), S142 (= S140), H144 (= H142), K152 (= K150), Y155 (= Y153), W187 (≠ Y185), Q196 (= Q194), W257 (= W255)
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), T13 (= T11), S14 (= S12), G15 (= G13), I16 (= I14), F36 (= F34), A62 (= A60), D63 (= D61), L64 (≠ M62), N90 (= N88), A91 (= A89), G92 (= G90), L113 (≠ V111), S142 (= S140), Y155 (= Y153), K159 (= K157), P185 (= P183), G186 (= G184), W187 (≠ Y185), V188 (= V186), T190 (= T188), L192 (= L190), V193 (= V191)
3vdrA Crystal structure of d-3-hydroxybutyrate dehydrogenase, prepared in the presence of the substrate d-3-hydroxybutyrate and NAD(+) (see paper)
53% identity, 99% coverage: 3:258/258 of query aligns to 5:260/260 of 3vdrA
- active site: G15 (= G13), N114 (= N112), S142 (= S140), Y155 (= Y153), K159 (= K157), I200 (≠ Q198)
- binding (3R)-3-hydroxybutanoic acid: Q94 (= Q92), H144 (= H142), K152 (= K150), Y155 (= Y153), W187 (≠ Y185), Q196 (= Q194), W257 (= W255)
- binding acetoacetic acid: Q94 (= Q92), H144 (= H142), K152 (= K150), Y155 (= Y153), W187 (≠ Y185), Q196 (= Q194), W257 (= W255)
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), T13 (= T11), I16 (= I14), F36 (= F34), D63 (= D61), L64 (≠ M62), N90 (= N88), A91 (= A89), G92 (= G90), L113 (≠ V111), K159 (= K157), G186 (= G184), V188 (= V186), T190 (= T188), L192 (= L190), V193 (= V191)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G9), T13 (= T11), I16 (= I14), F36 (= F34), D63 (= D61), L64 (≠ M62), N90 (= N88), A91 (= A89), G92 (= G90), L113 (≠ V111), S142 (= S140), Y155 (= Y153), K159 (= K157), G186 (= G184), V188 (= V186), T190 (= T188), L192 (= L190), V193 (= V191)
3vdqA Crystal structure of alcaligenes faecalis d-3-hydroxybutyrate dehydrogenase in complex with NAD(+) and acetate (see paper)
53% identity, 99% coverage: 3:258/258 of query aligns to 5:260/260 of 3vdqA
- active site: G15 (= G13), N114 (= N112), S142 (= S140), Y155 (= Y153), K159 (= K157), I200 (≠ Q198)
- binding acetate ion: Q94 (= Q92), H144 (= H142), K152 (= K150), W187 (≠ Y185), L192 (= L190), Q196 (= Q194)
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), S14 (= S12), I16 (= I14), F36 (= F34), D63 (= D61), L64 (≠ M62), N90 (= N88), A91 (= A89), G92 (= G90), L113 (≠ V111), I140 (= I138), S142 (= S140), Y155 (= Y153), K159 (= K157), P185 (= P183), G186 (= G184), W187 (≠ Y185), V188 (= V186), T190 (= T188), L192 (= L190), V193 (= V191)
2q2qD Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida (see paper)
54% identity, 99% coverage: 3:258/258 of query aligns to 5:255/255 of 2q2qD
- active site: G15 (= G13), S138 (= S140), Y151 (= Y153), K155 (= K157), R196 (≠ Q198)
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), T13 (= T11), S14 (= S12), G15 (= G13), I16 (= I14), F36 (= F34), D59 (= D61), L60 (≠ M62), N86 (= N88), G88 (= G90), L109 (≠ V111), I136 (= I138), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184), W183 (≠ Y185), V184 (= V186), T186 (= T188), L188 (= L190), V189 (= V191)
1x1tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas fragi complexed with NAD+ (see paper)
52% identity, 99% coverage: 3:258/258 of query aligns to 5:236/236 of 1x1tA
- active site: G15 (= G13), N114 (= N112), S142 (= S140), Y155 (= Y153), K159 (= K157)
- binding cacodylate ion: S142 (= S140), H144 (= H142), Y155 (= Y153), W187 (≠ Y185), W233 (= W255)
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), T13 (= T11), S14 (= S12), G15 (= G13), I16 (= I14), G35 (= G33), F36 (= F34), D63 (= D61), L64 (≠ M62), N90 (= N88), G92 (= G90), L113 (≠ V111), S142 (= S140), Y155 (= Y153), K159 (= K157), P185 (= P183), W187 (≠ Y185), V188 (= V186), T190 (= T188)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
42% identity, 99% coverage: 3:258/258 of query aligns to 8:261/261 of 6zzsD
- active site: G18 (= G13), S143 (= S140), Y156 (= Y153)
- binding nicotinamide-adenine-dinucleotide: G14 (= G9), S17 (= S12), I19 (= I14), D38 (≠ G33), M39 (≠ F34), D64 (= D61), V65 (≠ M62), N91 (= N88), A92 (= A89), G93 (= G90), M141 (≠ I138), A142 (= A139), S143 (= S140), Y156 (= Y153), K160 (= K157), P186 (= P183), G187 (= G184), V189 (= V186), T191 (= T188), L193 (= L190)
- binding 3-oxidanylidenepentanoic acid: Q95 (= Q92), S143 (= S140), N145 (≠ H142), K153 (= K150), Y156 (= Y153), Q197 (= Q194)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
42% identity, 99% coverage: 3:258/258 of query aligns to 7:260/260 of 6zzqA
- active site: G17 (= G13), S142 (= S140), Y155 (= Y153)
- binding acetoacetic acid: Q94 (= Q92), S142 (= S140), K152 (= K150), Y155 (= Y153), Q196 (= Q194)
- binding nicotinamide-adenine-dinucleotide: G13 (= G9), S16 (= S12), G17 (= G13), I18 (= I14), D37 (≠ G33), M38 (≠ F34), D63 (= D61), V64 (≠ M62), N90 (= N88), A91 (= A89), G92 (= G90), M140 (≠ I138), A141 (= A139), S142 (= S140), Y155 (= Y153), K159 (= K157), Y187 (= Y185), V188 (= V186), T190 (= T188)
6zzpA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and 3-oxovalerate (see paper)
43% identity, 98% coverage: 3:255/258 of query aligns to 11:262/265 of 6zzpA
- binding nicotinamide-adenine-dinucleotide: G17 (= G9), S20 (= S12), G21 (= G13), I22 (= I14), D41 (≠ G33), I42 (≠ F34), M66 (≠ A60), D67 (= D61), V68 (≠ M62), N94 (= N88), A95 (= A89), G96 (= G90), M145 (≠ I138), S147 (= S140), Y160 (= Y153), K164 (= K157), P190 (= P183), F192 (≠ Y185), V193 (= V186), T195 (= T188), L197 (= L190), V198 (= V191)
- binding 3-oxidanylidenepentanoic acid: Q98 (= Q92), S147 (= S140), H149 (= H142), K157 (= K150), Y160 (= Y153), F192 (≠ Y185), Q201 (= Q194)
6zzoC Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and acetoacetate (see paper)
43% identity, 98% coverage: 3:255/258 of query aligns to 11:262/265 of 6zzoC
- binding acetoacetic acid: Q98 (= Q92), H149 (= H142), K157 (= K150), F192 (≠ Y185), Q201 (= Q194)
- binding nicotinamide-adenine-dinucleotide: G17 (= G9), S20 (= S12), G21 (= G13), I22 (= I14), D41 (≠ G33), I42 (≠ F34), M66 (≠ A60), D67 (= D61), V68 (≠ M62), N94 (= N88), A95 (= A89), G96 (= G90), M145 (≠ I138), Y160 (= Y153), K164 (= K157), P190 (= P183), F192 (≠ Y185), V193 (= V186), T195 (= T188), L197 (= L190), V198 (= V191)
8dt1C Crystal structure of a putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 in complex with NAD
41% identity, 99% coverage: 3:258/258 of query aligns to 5:259/259 of 8dt1C
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), S14 (= S12), G15 (= G13), I16 (= I14), D35 (≠ G33), L36 (≠ F34), M60 (≠ A60), V62 (≠ M62), N88 (= N88), A89 (= A89), M139 (≠ I138), Y154 (= Y153), K158 (= K157), P184 (= P183), G185 (= G184), F186 (≠ Y185), V187 (= V186), T189 (= T188)
3sjuA Hedamycin polyketide ketoreductase bound to NADPH (see paper)
38% identity, 98% coverage: 3:254/258 of query aligns to 1:251/255 of 3sjuA
- active site: G11 (= G13), S138 (= S140), Y151 (= Y153), K155 (= K157), Y196 (≠ Q198)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G9), S10 (= S12), A31 (≠ P37), R32 (≠ D38), D33 (≠ E39), C56 (≠ A60), D57 (= D61), V58 (≠ M62), S84 (≠ N88), A85 (= A89), G86 (= G90), I136 (= I138), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184), Y183 (= Y185), V184 (= V186), T186 (= T188), M188 (≠ L190)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
32% identity, 99% coverage: 2:257/258 of query aligns to 5:247/248 of 6ixmC
- active site: G16 (= G13), S142 (= S140), Y155 (= Y153), K159 (= K157)
- binding nicotinamide-adenine-dinucleotide: G12 (= G9), S15 (= S12), G16 (= G13), I17 (= I14), D36 (≠ G33), I37 (≠ F34), A61 (= A60), D62 (= D61), T63 (≠ M62), N89 (= N88), A90 (= A89), M140 (≠ I138), S142 (= S140), Y155 (= Y153), K159 (= K157), P185 (= P183), A186 (≠ G184), Y187 (= Y185), I188 (≠ V186), L192 (= L190)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
34% identity, 98% coverage: 1:254/258 of query aligns to 3:243/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
33% identity, 98% coverage: 2:254/258 of query aligns to 1:236/239 of 3sj7A
- active site: G12 (= G13), S138 (= S140), Q148 (≠ K150), Y151 (= Y153), K155 (= K157)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), S10 (≠ T11), R11 (≠ S12), I13 (= I14), N31 (= N32), Y32 (≠ G33), A33 (≠ F34), G34 (= G35), S35 (≠ A36), A58 (≠ H57), N59 (≠ H58), V60 (≠ P59), N86 (= N88), A87 (= A89), T109 (≠ V111), S138 (= S140), Y151 (= Y153), K155 (= K157), P181 (= P183), G182 (= G184)
2cfcA Structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases (see paper)
37% identity, 100% coverage: 1:257/258 of query aligns to 1:249/250 of 2cfcA
- active site: G13 (= G13), S142 (= S140), Y155 (= Y153), K159 (= K157)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (≠ S147), R152 (≠ K150), Y155 (= Y153), W195 (≠ K193), R196 (≠ Q194)
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), S12 (= S12), G13 (= G13), N14 (≠ I14), D33 (≠ V30), L34 (= L31), A59 (= A60), D60 (= D61), V61 (≠ M62), N87 (= N88), A88 (= A89), G89 (= G90), I140 (= I138), P185 (= P183), G186 (= G184), M187 (≠ Y185), I188 (≠ V186), T190 (= T188), P191 (= P189), M192 (≠ L190), T193 (≠ V191)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
37% identity, 100% coverage: 1:257/258 of query aligns to 1:249/250 of Q56840
- M1 (= M1) modified: Initiator methionine, Removed
- SGN 12:14 (≠ SGI 12:14) binding
- D33 (≠ V30) binding
- DV 60:61 (≠ DM 61:62) binding
- N87 (= N88) binding
- S142 (= S140) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (≠ K150) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y153) mutation Y->E,F: Loss of activity.
- K159 (= K157) mutation to A: Loss of activity.
- R179 (≠ T177) mutation to A: Loss of activity.
- IETPM 188:192 (≠ VLTPL 186:190) binding
- WR 195:196 (≠ KQ 193:194) binding
- R196 (≠ Q194) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- R203 (= R202) mutation to A: Slight decrease in catalytic efficiency.
- R209 (≠ E212) mutation to A: Does not affect catalytic efficiency.
Query Sequence
>SM_b21010 FitnessBrowser__Smeli:SM_b21010
MTKTAVITGSTSGIGLAIARTLAKAGANIVLNGFGAPDEIRTVTDEVAGLSSGTVLHHPA
DMTKPSEIADMMAMVADRFGGADILVNNAGVQFVEKIEDFPVEQWDRIIAVNLSSSFHTI
RGAIPPMKKKGWGRIINIASAHGLVASPFKSAYVAAKHGIMGLTKTVALEVAESGVTVNS
ICPGYVLTPLVEKQIPDQARTRGITEEQVINEVMLKGQPTKKFITVEQVASLALYLAGDD
AAQITGTHVSMDGGWTAQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory