Comparing SM_b21082 FitnessBrowser__Smeli:SM_b21082 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
2x65B Crystal structure of t. Maritima gdp-mannose pyrophosphorylase in complex with mannose-1-phosphate. (see paper)
33% identity, 45% coverage: 5:348/767 of query aligns to 2:332/334 of 2x65B
2x65A Crystal structure of t. Maritima gdp-mannose pyrophosphorylase in complex with mannose-1-phosphate. (see paper)
33% identity, 45% coverage: 5:348/767 of query aligns to 2:332/334 of 2x65A
2x60A Crystal structure of t. Maritima gdp-mannose pyrophosphorylase in complex with gtp. (see paper)
33% identity, 45% coverage: 5:348/767 of query aligns to 2:332/333 of 2x60A
2x5zA Crystal structure of t. Maritima gdp-mannose pyrophosphorylase in complex with gdp-mannose. (see paper)
33% identity, 45% coverage: 5:348/767 of query aligns to 2:332/333 of 2x5zA
P32140 Sulfoquinovose isomerase; SQ isomerase; Sulfoquinovose-sulfofructose isomerase; SQ-SF isomerase; EC 5.3.1.31 from Escherichia coli (strain K12) (see paper)
28% identity, 34% coverage: 420:678/767 of query aligns to 54:333/413 of P32140
Sites not aligning to the query:
7ag4D Crystal structure of active site mutant of sq isomerase (yihs-h248a) from salmonella enterica in complex with sulfofructose (sf) (see paper)
28% identity, 33% coverage: 420:673/767 of query aligns to 66:340/425 of 7ag4D
Sites not aligning to the query:
2zblA Functional annotation of salmonella enterica yihs-encoded protein (see paper)
28% identity, 33% coverage: 420:673/767 of query aligns to 54:328/416 of 2zblA
Sites not aligning to the query:
8h1lB Crystal structure of glucose-2-epimerase in complex with d-glucitol from runella slithyformis runsl_4512 (see paper)
22% identity, 49% coverage: 372:743/767 of query aligns to 10:423/423 of 8h1lB
3wkiA Crystal structure of cellobiose 2-epimerase in complex with cellobiitol (see paper)
24% identity, 44% coverage: 379:714/767 of query aligns to 21:373/407 of 3wkiA
Sites not aligning to the query:
3wkhA Crystal structure of cellobiose 2-epimerase in complex with epilactose (see paper)
24% identity, 44% coverage: 379:714/767 of query aligns to 21:373/410 of 3wkhA
Sites not aligning to the query:
3wkgA Crystal structure of cellobiose 2-epimerase in complex with glucosylmannose (see paper)
24% identity, 44% coverage: 379:714/767 of query aligns to 21:373/410 of 3wkgA
Sites not aligning to the query:
>SM_b21082 FitnessBrowser__Smeli:SM_b21082
MPERISCFVMSGGVGSRLWPLSREDNPKQFHDLAGHGSMLVNTVRRLKARPAGDTPVHVI
ASERHSERVRADLAGIDLAGGHAIFEPVGRNTAAAVAVAALETIATHGDGLVLVVPSDHE
ISTEEQFWNTVEKGVPAAEAGRLVVFGIPPDSPETGYGYIESVGKGNVRDVARFVEKPGL
EMAKAYVASGTFFWNAGIFLFRAGAMRAAFREHQAAIWQKTECAFAAAATEVSGTYLPIE
QYSTIPSASIDYAIMEHASGIAMVPASFYWSDLGSWQSLLDISPTDGNGNVVIGDVVAID
CERSYLRSQGRLLSVIGLRDVAIVSTADATFVAPVAKSQEVKRIVEQLEKSGRLETKFTP
AHARVLQPGAWRERVAHWLFEETLPLWSTAGVDERHGGFHEALSFEAAPLIKPKRMRTMA
RQVYAFSVAKLRGWDGDADGLIGHGIAFMEKGRTQRGGWARVLQEDGTIADACEDAYDHA
CVLLMLAHAYQAGNPDALRLGQETFAFLDEHLEDDRLTGFLETSDGTELRRSNPHMHLLE
AFLAWYAATGERGYLRRAARIIDLFRSHFFDTESWTLGEYFDEAWNPAVGPKGQWTEPGH
HFEWASLLVEFAAKSRQTDLIAFARKLYASAIATGLNRSTGLAYGAVSRAALPLDLISRS
WPQAEAVKAALALEGTGGPDLKPEIEARVGRLFRWHIDPAPLGMWIDRVDEKGSAVATEV
PASIFYHLVTALMQYLDKTEEAVYRSPSFPQSINAAEPLAALNRETV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory