Comparing SM_b21109 FitnessBrowser__Smeli:SM_b21109 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
B9JK80 D-apiose dehydrogenase; EC 1.1.1.420 from Rhizobium rhizogenes (strain K84 / ATCC BAA-868) (Agrobacterium radiobacter)
26% identity, 74% coverage: 85:351/360 of query aligns to 72:338/345 of B9JK80
Sites not aligning to the query:
5uiaA Crystal structure of an oxidoreductase from agrobacterium radiobacter in complex with NAD+, r-2,3-dihydroxyisovalerate and magnesium
26% identity, 74% coverage: 85:351/360 of query aligns to 69:335/342 of 5uiaA
Sites not aligning to the query:
5ui9A Crystal structure of an oxidoreductase from agrobacterium radiobacter in complex with NAD+, 2 -hydroxy-2-hydroxymethyl propanoic acid and magnesium
26% identity, 74% coverage: 85:351/360 of query aligns to 69:335/342 of 5ui9A
Sites not aligning to the query:
5uhzA Crystal structure of an oxidoreductase from agrobacterium radiobacter in complex with NAD+, d-apionate and magnesium
26% identity, 74% coverage: 85:351/360 of query aligns to 69:335/342 of 5uhzA
Sites not aligning to the query:
5uhwA Crystal structure of an oxidoreductase from agrobacterium radiobacter in complex with NAD+ and magnesium
26% identity, 74% coverage: 85:351/360 of query aligns to 69:335/342 of 5uhwA
Sites not aligning to the query:
1zh8A Crystal structure of oxidoreductase (tm0312) from thermotoga maritima at 2.50 a resolution
21% identity, 91% coverage: 25:350/360 of query aligns to 8:319/325 of 1zh8A
>SM_b21109 FitnessBrowser__Smeli:SM_b21109
MTETFDPSSLRQWWPKPVAPRPIVIFGAGSIVGDAHLPAYRNAGFPVAGIFDPDAGKAAA
LARASDVMAFTSEEEALSAENAIFDLATPPAAHASILSKLPKGSFALIQKPLGSDLAAAT
GILEICRERNIRAAANFQLRFAPMMLALKDAIATGYLGEVVDFDAWLALATPWGLWPFLK
GLPRIEIAMHSIHYLDLVRSLLGDPRGVHAKTIGHPNHDVAQTRTAAILDYGDAVRCVLS
VNHDHDFGRRFQACEFRICGTRGAAYVKLGVNLDYPRGEPDELWIRPAGGADWIQVPLEG
SWFPDAFANRMANLQRHAGGEDDELIGSVEDAWRTMALVEAAYQSSARPATPIAALPLEN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory