SitesBLAST
Comparing SM_b21124 FitnessBrowser__Smeli:SM_b21124 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8j78I Human 3-methylcrotonyl-coa carboxylase in bccp-h2 state
45% identity, 99% coverage: 2:659/662 of query aligns to 4:651/651 of 8j78I
8rthA Trypanosoma brucei 3-methylcrotonyl-coa carboxylase (see paper)
46% identity, 100% coverage: 2:661/662 of query aligns to 2:666/666 of 8rthA
P9WPQ3 Biotin-dependent 3-methylcrotonyl-coenzyme A carboxylase alpha1 subunit; EC 6.3.4.14 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
46% identity, 99% coverage: 1:658/662 of query aligns to 1:654/654 of P9WPQ3
- K322 (≠ P325) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
7ybuA Human propionyl-coenzyme a carboxylase
42% identity, 99% coverage: 2:656/662 of query aligns to 5:669/670 of 7ybuA
P05165 Propionyl-CoA carboxylase alpha chain, mitochondrial; PCCase subunit alpha; Propanoyl-CoA:carbon dioxide ligase subunit alpha; EC 6.4.1.3 from Homo sapiens (Human) (see 6 papers)
42% identity, 99% coverage: 2:656/662 of query aligns to 63:727/728 of P05165
- A75 (= A14) to P: in PA-1; dbSNP:rs794727479
- R77 (= R16) to W: in PA-1; loss of function; dbSNP:rs141371306
- A138 (= A77) to T: in PA-1; loss of function; dbSNP:rs202247814
- I164 (≠ V103) to T: in PA-1; loss of function; dbSNP:rs202247815
- G197 (= G136) to E: in PA-1
- M229 (= M168) to K: in PA-1; dbSNP:rs375628794
- Q297 (= Q236) to R: in PA-1
- D368 (= D312) to G: in PA-1
- M373 (≠ Q317) to K: in PA-1; unstable protein; loss of function; dbSNP:rs121964958
- G379 (= G323) to V: in PA-1; dbSNP:rs794727087
- C398 (≠ A342) to R: in PA-1
- R399 (= R343) to Q: in PA-1; dbSNP:rs1301904623
- P423 (= P366) to L: in PA-1; dbSNP:rs1443858896
- L532 (≠ G459) natural variant: Missing (in PA-1)
- V551 (≠ N477) to F: in dbSNP:rs61749895
- W559 (= W489) to L: in PA-1; dbSNP:rs118169528
- G631 (= G567) to R: in PA-1; loss of function; dbSNP:rs796052018
- G668 (= G597) to R: in PA-1; loss of biotinylation; dbSNP:rs771438170
- K694 (= K623) modified: N6-biotinyllysine; by HLCS
- C712 (≠ V641) natural variant: Missing (in PA-1; loss of biotinylation)
Sites not aligning to the query:
- 1:52 modified: transit peptide, Mitochondrion
Q5LUF3 Propionyl-CoA carboxylase alpha chain; EC 6.4.1.3 from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) (Silicibacter pomeroyi) (see paper)
42% identity, 99% coverage: 1:656/662 of query aligns to 1:680/681 of Q5LUF3
- F348 (= F353) binding
- W515 (≠ R497) mutation to L: No effect on holoenzyme formation.
- L599 (= L570) mutation to A: Loss of holoenzyme formation; when associated with A-602 and A-603.
- L602 (≠ H573) mutation to A: Loss of holoenzyme formation; when associated with A-602 and A-603.
- M603 (≠ V574) mutation to A: No effect on holoenzyme formation. Loss of holoenzyme formation; when associated with A-602 and A-603.
- K647 (= K623) modified: N6-biotinyllysine
3n6rG Crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc) (see paper)
42% identity, 99% coverage: 2:654/662 of query aligns to 1:643/646 of 3n6rG
- active site: K115 (= K116), K157 (= K158), D180 (= D194), H193 (= H208), R219 (= R234), T258 (= T273), E260 (= E275), E273 (= E293), N275 (= N295), R277 (= R297), E281 (= E301), R323 (= R343), G519 (vs. gap)
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: M611 (= M622), K612 (= K623)
2vr1A Crystal structure of biotin carboxylase from e. Coli in complex with atp analog, adpcf2p. (see paper)
50% identity, 68% coverage: 1:449/662 of query aligns to 1:442/444 of 2vr1A
- active site: K116 (= K116), K159 (= K158), D194 (≠ G195), H207 (= H208), R233 (= R234), T272 (= T273), E274 (= E275), E286 (= E293), N288 (= N295), R290 (= R297), E294 (= E301), R336 (= R343)
- binding phosphodifluoromethylphosphonic acid-adenylate ester: K159 (= K158), R165 (≠ K166), M167 (= M168), Y201 (= Y202), L202 (= L203), E274 (= E275), L276 (≠ I277), E286 (= E293), N288 (= N295), I435 (≠ T442)
4mv4A Crystal structure of biotin carboxylase from haemophilus influenzae in complex with amppcp and mg2 (see paper)
51% identity, 68% coverage: 1:449/662 of query aligns to 1:441/442 of 4mv4A
- active site: K116 (= K116), K159 (= K158), D193 (≠ G195), H206 (= H208), R232 (= R234), T271 (= T273), E273 (= E275), E285 (= E293), N287 (= N295), R289 (= R297), E293 (= E301), R335 (= R343)
- binding phosphomethylphosphonic acid adenylate ester: K159 (= K158), G164 (= G163), M166 (= M168), E198 (= E200), Y200 (= Y202), L201 (= L203), H233 (= H235), L275 (≠ I277), E285 (= E293)
- binding magnesium ion: E273 (= E275), E285 (= E293)
4mv3A Crystal structure of biotin carboxylase from haemophilus influenzae in complex with amppcp and bicarbonate (see paper)
50% identity, 68% coverage: 1:449/662 of query aligns to 1:438/439 of 4mv3A
- active site: K116 (= K116), K159 (= K158), D190 (≠ G195), H203 (= H208), R229 (= R234), T268 (= T273), E270 (= E275), E282 (= E293), N284 (= N295), R286 (= R297), E290 (= E301), R332 (= R343)
- binding phosphomethylphosphonic acid adenylate ester: K159 (= K158), M163 (= M168), E195 (= E200), Y197 (= Y202), L198 (= L203), E270 (= E275), L272 (≠ I277), E282 (= E293)
- binding bicarbonate ion: R286 (= R297), Q288 (= Q299), V289 (= V300)
6oi8A Crystal structure of haemophilus influenzae biotin carboxylase complexed with 7-((1r,5s,6s)-6-amino-3-azabicyclo[3.1.0]hexan-3-yl)- 6-(2-chloro-6-(pyridin-3-yl)phenyl)pyrido[2,3-d]pyrimidin-2-amine (see paper)
50% identity, 68% coverage: 1:449/662 of query aligns to 1:439/440 of 6oi8A
- active site: K116 (= K116), K159 (= K158), D191 (≠ G195), H204 (= H208), R230 (= R234), T269 (= T273), E271 (= E275), E283 (= E293), N285 (= N295), R287 (= R297), E291 (= E301), R333 (= R343)
- binding 7-[(1R,5S,6s)-6-amino-3-azabicyclo[3.1.0]hexan-3-yl]-6-[2-chloro-6-(pyridin-3-yl)phenyl]pyrido[2,3-d]pyrimidin-2-amine: I157 (≠ L156), K159 (= K158), M164 (= M168), E196 (= E200), Y198 (= Y202), L199 (= L203), H204 (= H208), Q228 (= Q232), E271 (= E275), L273 (≠ I277), E283 (= E293), I432 (≠ T442)
2vpqB Crystal structure of biotin carboxylase from s. Aureus complexed with amppnp (see paper)
49% identity, 67% coverage: 3:447/662 of query aligns to 1:442/448 of 2vpqB
- active site: V116 (≠ A118), K156 (= K158), H206 (= H208), R232 (= R234), T271 (= T273), E273 (= E275), E287 (= E293), N289 (= N295), R291 (= R297), E295 (= E301), R337 (= R343)
- binding phosphoaminophosphonic acid-adenylate ester: K114 (= K116), I154 (≠ L156), K156 (= K158), G161 (= G163), G163 (= G165), I166 (≠ M168), F200 (≠ Y202), I201 (≠ L203), E273 (= E275), I275 (= I277), M286 (= M292), E287 (= E293)
- binding magnesium ion: E273 (= E275), E287 (= E293)
3jziA Crystal structure of biotin carboxylase from e. Coli in complex with benzimidazole series (see paper)
50% identity, 68% coverage: 1:449/662 of query aligns to 1:444/445 of 3jziA
- active site: K116 (= K116), K159 (= K158), D196 (≠ G195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E293), N290 (= N295), R292 (= R297), E296 (= E301), R338 (= R343)
- binding 7-amino-2-[(2-chlorobenzyl)amino]-1-{[(1S,2S)-2-hydroxycycloheptyl]methyl}-1H-benzimidazole-5-carboxamide: K116 (= K116), K159 (= K158), A160 (= A159), G164 (= G163), G165 (= G164), M169 (= M168), Y199 (≠ L198), E201 (= E200), K202 (≠ R201), Y203 (= Y202), H209 (= H208), Q233 (= Q232), H236 (= H235), L278 (≠ I277), I287 (≠ M292), E288 (= E293)
2w6oA Crystal structure of biotin carboxylase from e. Coli in complex with 4-amino-7,7-dimethyl-7,8-dihydro-quinazolinone fragment (see paper)
50% identity, 68% coverage: 1:449/662 of query aligns to 1:444/445 of 2w6oA
- active site: K116 (= K116), K159 (= K158), D196 (≠ G195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E293), N290 (= N295), R292 (= R297), E296 (= E301), R338 (= R343)
- binding 4-amino-7,7-dimethyl-7,8-dihydroquinazolin-5(6H)-one: K159 (= K158), K202 (≠ R201), Y203 (= Y202), L204 (= L203), L278 (≠ I277), I437 (≠ T442)
2w6nA Crystal structure of biotin carboxylase from e. Coli in complex with amino-oxazole fragment series (see paper)
50% identity, 68% coverage: 1:449/662 of query aligns to 1:444/445 of 2w6nA
- active site: K116 (= K116), K159 (= K158), D196 (≠ G195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E293), N290 (= N295), R292 (= R297), E296 (= E301), R338 (= R343)
- binding 2-amino-n,n-bis(phenylmethyl)-1,3-oxazole-5-carboxamide: I157 (≠ L156), K159 (= K158), M169 (= M168), E201 (= E200), K202 (≠ R201), Y203 (= Y202), L278 (≠ I277)
2v59A Crystal structure of biotin carboxylase from e.Coli in complex with potent inhibitor 2 (see paper)
50% identity, 68% coverage: 1:449/662 of query aligns to 1:444/445 of 2v59A
- active site: K116 (= K116), K159 (= K158), D196 (≠ G195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E293), N290 (= N295), R292 (= R297), E296 (= E301), R338 (= R343)
- binding 6-(2,6-dimethoxyphenyl)pyrido[2,3-d]pyrimidine-2,7-diamine: K159 (= K158), Y203 (= Y202), L204 (= L203), H209 (= H208), Q233 (= Q232), H236 (= H235), L278 (≠ I277), I437 (≠ T442)
P24182 Biotin carboxylase; Acetyl-coenzyme A carboxylase biotin carboxylase subunit A; EC 6.3.4.14 from Escherichia coli (strain K12) (see 3 papers)
50% identity, 68% coverage: 1:449/662 of query aligns to 1:444/449 of P24182
- R19 (= R19) mutation to E: Loss of homodimerization. No effect on ATP binding.
- E23 (≠ R23) mutation to R: Loss of homodimerization. No effect on ATP binding.
- K116 (= K116) binding
- K159 (= K158) binding
- GG 165:166 (= GG 164:165) binding
- EKYL 201:204 (≠ ERYL 200:203) binding
- H209 (= H208) binding
- H236 (= H235) binding
- K238 (= K237) binding
- E276 (= E275) binding ; binding
- E288 (= E293) binding ; binding
- R292 (= R297) active site; binding
- V295 (= V300) binding
- E296 (= E301) mutation to A: Severe reduction in catalytic activity.
- R338 (= R343) binding ; binding ; mutation to A: Severe reduction in catalytic activity.
- F363 (≠ T369) mutation to A: Loss of homodimerization. No effect on ATP binding.
- R366 (= R371) mutation to E: Loss of homodimerization. No effect on ATP binding.
3jzfB Crystal structure of biotin carboxylase from e. Coli in complex with benzimidazoles series (see paper)
50% identity, 68% coverage: 1:449/662 of query aligns to 3:446/447 of 3jzfB
- active site: K118 (= K116), K161 (= K158), D198 (≠ G195), H211 (= H208), R237 (= R234), T276 (= T273), E278 (= E275), E290 (= E293), N292 (= N295), R294 (= R297), E298 (= E301), R340 (= R343)
- binding 2-[(2-chlorobenzyl)amino]-1-(cyclohexylmethyl)-1H-benzimidazole-5-carboxamide: K118 (= K116), K161 (= K158), A162 (= A159), G166 (= G163), G168 (= G165), R169 (≠ K166), G170 (= G167), M171 (= M168), Y201 (≠ L198), E203 (= E200), K204 (≠ R201), Y205 (= Y202), H211 (= H208), H238 (= H235), L280 (≠ I277), I289 (≠ M292), E290 (= E293)
3rupA Crystal structure of e.Coli biotin carboxylase in complex with two adp and two ca ions (see paper)
50% identity, 68% coverage: 1:449/662 of query aligns to 1:444/444 of 3rupA
- active site: K116 (= K116), K159 (= K158), D196 (≠ G195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E293), N290 (= N295), R292 (= R297), E296 (= E301), R338 (= R343)
- binding adenosine-5'-diphosphate: Y82 (= Y82), G83 (= G83), K116 (= K116), K159 (= K158), G164 (= G163), G164 (= G163), G165 (= G164), G166 (= G165), R167 (≠ K166), M169 (= M168), F193 (= F192), E201 (= E200), K202 (≠ R201), Y203 (= Y202), L204 (= L203), H209 (= H208), Q233 (= Q232), H236 (= H235), K238 (= K237), L278 (≠ I277), E288 (= E293), R292 (= R297), V295 (= V300), E296 (= E301), R338 (= R343), D382 (= D387), I437 (≠ T442)
- binding calcium ion: E87 (= E87), E276 (= E275), E288 (= E293), E288 (= E293), N290 (= N295)
3g8cA Crystal structure of biotin carboxylase in complex with biotin, bicarbonate, adp and mg ion (see paper)
50% identity, 68% coverage: 1:449/662 of query aligns to 1:444/444 of 3g8cA
- active site: K116 (= K116), K159 (= K158), D196 (≠ G195), H209 (= H208), R235 (= R234), T274 (= T273), E276 (= E275), E288 (= E293), N290 (= N295), R292 (= R297), E296 (= E301), R338 (= R343)
- binding adenosine-5'-diphosphate: I157 (≠ L156), K159 (= K158), G164 (= G163), M169 (= M168), E201 (= E200), K202 (≠ R201), Y203 (= Y202), L204 (= L203), Q233 (= Q232), H236 (= H235), L278 (≠ I277), E288 (= E293), I437 (≠ T442)
- binding bicarbonate ion: K238 (= K237), R292 (= R297), Q294 (= Q299), V295 (= V300), E296 (= E301)
- binding biotin: Y82 (= Y82), F84 (= F84), R292 (= R297), V295 (= V300), R338 (= R343), D382 (= D387)
- binding magnesium ion: E276 (= E275), E288 (= E293)
Query Sequence
>SM_b21124 FitnessBrowser__Smeli:SM_b21124
MFSKLLIANRGEIACRIIRTARRLGIRTVAVYSDADGDALHVALADEAIRIGGAPAAESY
LASAPIVQAARSVGAQAIHPGYGFLSENADFAEAVAEAGMIFVGPPPAAIRAMGLKDAAK
ALMERSGVPVVPGYHGEEQDASFLADRAREIGYPVLIKARAGGGGKGMRRVERQEDFGPA
LEAARREAESAFGDGSVLLERYLTKPRHIEMQVFGDRHGNIVHLFERDCSLQRRHQKVIE
EAPAPGMTAEVRRAMGDAAVRAAQAIGYVGAGTVEFIADVTNGLWPDHFYFMEMNTRLQV
EHPVTEAITGIDLVEWQLRVASGEPLPKKQADISMNGWAFEARLYAEDPARGFLPATGRL
TELSFPEGTSRVDSGVRQGDTITPYYDPLIAKLIVHGQNRSAALGRLQDALKECRIGGTV
TNRDFLIRLTEEHDFRSGHPDTGLIDREIERLTAPVAPGDEALALAAIFSTGALDPNRST
DPWSSLGSWQIWGDAHRMVVIEHADVRATVTLASRGRDQFAVRAGASTLPVLVLDRFEGG
ARLEVAGQKRLIRFSRDREALTLFHGGRNLVFHVPDGLTGGQSSEIADDELVAPMPGLVK
LVRVGAGDAVTKGQALVVMEAMKMELTLSASREGTIANVHVAEGAQVSEGTVLVTLMEEA
AQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory