SitesBLAST
Comparing SM_b21126 FitnessBrowser__Smeli:SM_b21126 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
31% identity, 100% coverage: 1:260/261 of query aligns to 1:257/259 of 5zaiC
- active site: A65 (≠ G66), F70 (= F75), S82 (≠ A90), R86 (≠ K94), G110 (= G114), E113 (≠ G117), P132 (≠ T136), E133 (= E137), I138 (≠ L142), P140 (= P144), G141 (≠ A145), A226 (≠ I228), F236 (≠ W239)
- binding coenzyme a: K24 (= K25), L25 (≠ H26), A63 (= A64), G64 (= G65), A65 (≠ G66), D66 (= D67), I67 (≠ L68), P132 (≠ T136), R166 (≠ V169), F248 (= F251), K251 (≠ R254)
2uzfA Crystal structure of staphylococcus aureus 1,4-dihydroxy-2-naphthoyl coa synthase (menb) in complex with acetoacetyl coa (see paper)
31% identity, 99% coverage: 3:261/261 of query aligns to 7:255/260 of 2uzfA
- active site: G70 (= G66), R80 (= R82), L84 (≠ A90), G108 (= G114), V111 (≠ G117), T130 (= T136), G131 (≠ E137), S136 (≠ L142), D138 (≠ P144), A139 (= A145), A225 (= A236), Y233 (≠ W239)
- binding acetoacetyl-coenzyme a: V28 (≠ K25), R29 (≠ H26), S68 (≠ A64), G69 (= G65), G70 (= G66), D71 (= D67), Y104 (≠ N110), G108 (= G114)
Q5HH38 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Staphylococcus aureus (strain COL) (see paper)
31% identity, 99% coverage: 3:261/261 of query aligns to 12:268/273 of Q5HH38
- R34 (≠ H26) binding in other chain
- SGGDQ 73:77 (≠ AGGDL 64:68) binding in other chain
- S149 (≠ L142) binding in other chain
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
32% identity, 99% coverage: 1:259/261 of query aligns to 1:254/255 of 3q0jC
- active site: A65 (≠ G66), M70 (= M71), T80 (= T81), F84 (≠ E85), G108 (= G114), E111 (≠ G117), P130 (≠ T136), E131 (= E137), V136 (≠ L142), P138 (= P144), G139 (≠ A145), L224 (≠ I228), F234 (≠ W239)
- binding acetoacetyl-coenzyme a: Q23 (≠ E24), A24 (≠ K25), L25 (≠ H26), A27 (= A28), A63 (= A64), G64 (= G65), A65 (≠ G66), D66 (= D67), I67 (≠ L68), K68 (≠ D69), M70 (= M71), F84 (≠ E85), G107 (= G113), G108 (= G114), E111 (≠ G117), P130 (≠ T136), E131 (= E137), P138 (= P144), G139 (≠ A145), M140 (≠ T146)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
32% identity, 99% coverage: 1:259/261 of query aligns to 1:254/255 of 3q0gC
- active site: A65 (≠ G66), M70 (= M71), T80 (= T81), F84 (≠ E85), G108 (= G114), E111 (≠ G117), P130 (≠ T136), E131 (= E137), V136 (≠ L142), P138 (= P144), G139 (≠ A145), L224 (≠ I228), F234 (≠ W239)
- binding coenzyme a: L25 (≠ H26), A63 (= A64), I67 (≠ L68), K68 (≠ D69), Y104 (≠ N110), P130 (≠ T136), E131 (= E137), L134 (= L140)
Q8GYN9 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal; DHNS; Enoyl-CoA hydratase/isomerase D; ECHID; Naphthoate synthase; EC 4.1.3.36 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 97% coverage: 9:261/261 of query aligns to 82:332/337 of Q8GYN9
Sites not aligning to the query:
- 20 H→V: Loss of peroxisomal targeting.
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
32% identity, 99% coverage: 2:259/261 of query aligns to 1:253/256 of 3h81A
- active site: A64 (≠ G66), M69 (= M71), T79 (= T81), F83 (≠ E85), G107 (= G114), E110 (≠ G117), P129 (≠ T136), E130 (= E137), V135 (≠ L142), P137 (= P144), G138 (≠ A145), L223 (≠ I228), F233 (≠ W239)
- binding calcium ion: F233 (≠ W239), Q238 (≠ A244)
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
32% identity, 99% coverage: 2:259/261 of query aligns to 1:249/250 of 3q0gD
- active site: A64 (≠ G66), M69 (= M71), T75 (≠ S76), F79 (≠ I83), G103 (= G114), E106 (≠ G117), P125 (≠ T136), E126 (= E137), V131 (≠ L142), P133 (= P144), G134 (≠ A145), L219 (≠ I228), F229 (≠ W239)
- binding Butyryl Coenzyme A: F225 (≠ L235), F241 (= F251)
5jbxB Crystal structure of liuc in complex with coenzyme a and malonic acid (see paper)
31% identity, 96% coverage: 10:260/261 of query aligns to 9:259/261 of 5jbxB
- active site: A67 (≠ G66), R72 (= R72), L84 (≠ A84), R88 (= R88), G112 (= G114), E115 (≠ G117), T134 (= T136), E135 (= E137), I140 (≠ L142), P142 (= P144), G143 (≠ A145), A228 (= A229), L238 (≠ W239)
- binding coenzyme a: S24 (≠ E24), R25 (≠ K25), R26 (≠ H26), A28 (= A28), A65 (= A64), D68 (= D67), L69 (= L68), K70 (≠ D69), L110 (≠ F112), G111 (= G113), T134 (= T136), E135 (= E137), L138 (= L140), R168 (≠ V169)
5du6A Crystal structure of m. Tuberculosis echa6 bound to ligand gsk059a. (see paper)
32% identity, 94% coverage: 15:260/261 of query aligns to 11:240/242 of 5du6A
- active site: A61 (≠ G66), P71 (= P80), I75 (≠ A84), A99 (≠ G114), Q102 (≠ G117), P121 (≠ T136), T122 (≠ E137), L127 (= L142), L129 (≠ I147), D130 (≠ S148), P209 (≠ A229), W219 (= W239)
- binding (5R,7R)-5-(4-ethylphenyl)-N-(4-fluorobenzyl)-7-methyl-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxamide: L74 (≠ I83), D82 (≠ N97), D130 (≠ S148), W132 (≠ Y150), A207 (≠ V227), K212 (≠ I232), F215 (≠ L235)
6slbAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
32% identity, 95% coverage: 12:260/261 of query aligns to 10:255/257 of 6slbAAA
- active site: Q64 (≠ G66), F69 (= F75), L80 (≠ A86), N84 (≠ A90), A108 (≠ G114), S111 (≠ G117), A130 (≠ T136), F131 (≠ E137), L136 (= L142), P138 (= P144), D139 (≠ A145), A224 (≠ I228), G234 (≠ W239)
- binding (~{E})-6-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-6-oxidanylidene-hex-3-enoic acid: R58 (≠ K60), A62 (= A64), Q64 (≠ G66), D65 (= D67), L66 (= L68), Y76 (≠ R82), A108 (≠ G114), F131 (≠ E137), D139 (≠ A145)
5ducA Crystal structure of m. Tuberculosis echa6 bound to ligand gsk951a (see paper)
32% identity, 94% coverage: 15:260/261 of query aligns to 11:242/244 of 5ducA
- active site: A61 (≠ G66), D66 (≠ Q73), P73 (= P80), I77 (≠ A84), A101 (≠ G114), Q104 (≠ G117), P123 (≠ T136), T124 (≠ E137), L129 (= L142), L131 (≠ I147), D132 (≠ S148), P211 (≠ A229), W221 (= W239)
- binding (5R,7S)-N-(1,3-benzodioxol-5-ylmethyl)-5-(4-ethylphenyl)-7-(trifluoromethyl)-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxamide: L76 (≠ I83), H80 (≠ L93), D84 (≠ N97), Q104 (≠ G117), D132 (≠ S148), W134 (≠ Y150), F217 (≠ L235)
5du4A Crystal structure of m. Tuberculosis echa6 bound to ligand gsk366a (see paper)
32% identity, 94% coverage: 15:260/261 of query aligns to 11:242/244 of 5du4A
- active site: A61 (≠ G66), D66 (≠ Q73), P73 (= P80), I77 (≠ A84), A101 (≠ G114), Q104 (≠ G117), P123 (≠ T136), T124 (≠ E137), L129 (= L142), L131 (≠ I147), D132 (≠ S148), P211 (≠ A229), W221 (= W239)
- binding (5R,7S)-5-(4-ethylphenyl)-N-(4-methoxybenzyl)-7-(trifluoromethyl)-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxamide: L76 (≠ I83), I77 (≠ A84), H80 (≠ L93), D84 (≠ N97), Q104 (≠ G117), D132 (≠ S148), W134 (≠ Y150)
5dtwA Crystal structure of m. Tuberculosis echa6 bound to c20-coa (see paper)
32% identity, 94% coverage: 15:260/261 of query aligns to 11:242/244 of 5dtwA
- active site: A61 (≠ G66), D66 (≠ Q73), P73 (= P80), I77 (≠ A84), A101 (≠ G114), Q104 (≠ G117), P123 (≠ T136), T124 (≠ E137), L129 (= L142), L131 (≠ I147), D132 (≠ S148), P211 (≠ A229), W221 (= W239)
- binding Arachinoyl-CoA: R18 (= R22), E20 (= E24), R21 (≠ K25), R21 (≠ K25), R22 (≠ H26), A24 (= A28), A59 (= A64), A61 (≠ G66), D62 (= D67), L63 (= L68), H80 (≠ L93), D84 (≠ N97), G100 (= G113), A101 (≠ G114), Y127 (≠ L140), W134 (≠ Y150)
5dufA Crystal structure of m. Tuberculosis echa6 bound to ligand gsk729a (see paper)
32% identity, 94% coverage: 15:260/261 of query aligns to 12:243/245 of 5dufA
- active site: A62 (≠ G66), D67 (≠ Q73), P74 (= P80), I78 (≠ A84), A102 (≠ G114), Q105 (≠ G117), P124 (≠ T136), T125 (≠ E137), L130 (= L142), L132 (≠ I147), D133 (≠ S148), P212 (≠ A229), W222 (= W239)
- binding (5R,7S)-5-(4-ethylphenyl)-7-(trifluoromethyl)-4,5,6,7-tetrahydropyrazolo[1,5-a]pyrimidine-3-carboxylic acid: L77 (≠ I83), I78 (≠ A84), H81 (≠ L93), D85 (≠ N97), Q105 (≠ G117), D133 (≠ S148), W135 (≠ Y150)
6p5uE Structure of an enoyl-coa hydratase/aldolase isolated from a lignin- degrading consortium (see paper)
33% identity, 89% coverage: 5:236/261 of query aligns to 7:243/246 of 6p5uE
- active site: M67 (≠ G66), Y72 (≠ W70), D77 (≠ F75), R89 (≠ L89), A93 (vs. gap), G117 (= G114), T120 (≠ G117), E140 (= E137), I145 (≠ L142), P147 (= P144), A148 (= A145), A236 (= A229)
- binding coenzyme a: D25 (≠ E24), K26 (= K25), R27 (≠ H26), A29 (= A28), A65 (= A64), M67 (≠ G66), D68 (= D67), L69 (= L68), W113 (≠ N110), F115 (= F112), S139 (≠ T136), W143 (≠ L140)
Sites not aligning to the query:
Q13825 Methylglutaconyl-CoA hydratase, mitochondrial; 3-MG-CoA hydratase; AU-specific RNA-binding enoyl-CoA hydratase; AU-binding protein/enoyl-CoA hydratase; Itaconyl-CoA hydratase; EC 4.2.1.18; EC 4.2.1.56 from Homo sapiens (Human) (see 4 papers)
32% identity, 96% coverage: 11:260/261 of query aligns to 85:337/339 of Q13825
- K105 (≠ A31) mutation to N: Abolishes RNA-binding; when associated with E-109 and Q-113.
- 105:119 (vs. 31:45, 27% identical) RNA-binding
- K109 (≠ G35) mutation to E: Abolishes RNA-binding; when associated with N-105 and Q-113.
- K113 (≠ A39) mutation to Q: Abolishes RNA-binding; when associated with N-105 and E-109.
- A240 (= A167) to V: in MGCA1; decreased methylglutaconyl-CoA hydratase activity; dbSNP:rs769894315
Sites not aligning to the query:
- 1:67 modified: transit peptide, Mitochondrion
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
28% identity, 94% coverage: 15:260/261 of query aligns to 16:252/254 of 2dubA
- active site: A67 (≠ G66), M72 (= M71), S82 (≠ T81), G105 (= G114), E108 (≠ G117), P127 (≠ T136), E128 (= E137), T133 (≠ L142), P135 (= P144), G136 (≠ A145), K221 (vs. gap), F231 (≠ W239)
- binding octanoyl-coenzyme a: K25 (≠ E24), A26 (≠ K25), L27 (≠ H26), A29 (= A28), A65 (= A64), A67 (≠ G66), D68 (= D67), I69 (≠ L68), K70 (≠ D69), G105 (= G114), E108 (≠ G117), P127 (≠ T136), E128 (= E137), G136 (≠ A145), A137 (≠ T146)
Q7CQ56 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
27% identity, 99% coverage: 3:261/261 of query aligns to 22:280/285 of Q7CQ56
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
32% identity, 95% coverage: 12:260/261 of query aligns to 7:243/245 of 6slaAAA
- active site: Q61 (≠ G66), L68 (≠ A77), N72 (≠ T81), A96 (≠ G114), S99 (≠ G117), A118 (≠ T136), F119 (≠ E137), L124 (= L142), P126 (= P144), N127 (≠ A145), A212 (≠ I228), G222 (≠ W239)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (≠ H26), A59 (= A64), Q61 (≠ G66), D62 (= D67), L63 (= L68), L68 (≠ A77), Y71 (≠ P80), A94 (≠ F112), G95 (= G113), A96 (≠ G114), F119 (≠ E137), I122 (≠ L140), L124 (= L142), N127 (≠ A145), F234 (= F251), K237 (≠ R254)
Query Sequence
>SM_b21126 FitnessBrowser__Smeli:SM_b21126
MTFDTIRCAIDQRGVARVTLARSEKHNALSATMIGELTAVVGRLATDASIRAVILDAEGK
SFCAGGDLDWMRQQFSADRPTRIAEATRLAMMLKALNDLPKPLIARVHGNAFGGGVGLIS
VCDTVIAASGAQFGLTETRLGLIPATISPYVIARTGEARARPLFMSARVFGAEEAKVAGF
VTTVVDGTMLDGAVEAAVTAYLVAAPGAAGRAKRLARSLGLPITDAVIAATIEQLADTWE
TDEAREGVSAFFERRNPSWRQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory