SitesBLAST
Comparing SM_b21129 FitnessBrowser__Smeli:SM_b21129 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
43% identity, 94% coverage: 26:439/442 of query aligns to 44:465/465 of 3pm9A
- active site: A149 (= A131), L159 (≠ V141)
- binding flavin-adenine dinucleotide: P69 (= P51), Q70 (= Q52), G71 (= G53), G72 (= G54), N73 (≠ L55), T74 (= T56), G75 (= G57), L76 (= L58), G79 (= G61), Q80 (≠ A62), L91 (= L73), L133 (= L115), G134 (= G116), A135 (= A117), C139 (= C121), T140 (≠ Q122), G142 (= G124), G143 (= G125), S146 (≠ A128), T147 (= T129), A149 (= A131), G150 (= G132), E200 (= E182), G201 (= G183), I205 (= I187), I206 (= I188), E423 (= E397)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
39% identity, 94% coverage: 26:441/442 of query aligns to 50:466/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (= R308), T337 (≠ G310), K348 (≠ N321), Y379 (≠ F354), H381 (= H356), H388 (= H363), H423 (= H398)
- binding flavin-adenine dinucleotide: P75 (= P51), Q76 (= Q52), G77 (= G53), G78 (= G54), N79 (≠ L55), T80 (= T56), G81 (= G57), M82 (≠ L58), G85 (= G61), S86 (≠ A62), L139 (= L115), G140 (= G116), A141 (= A117), C145 (= C121), G149 (= G125), N150 (= N126), A152 (= A128), T153 (= T129), G157 (= G133), G207 (= G183), I212 (= I188), E422 (= E397), N459 (= N434)
- binding zinc ion: H381 (= H356), H388 (= H363), E422 (= E397)
Sites not aligning to the query:
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
39% identity, 94% coverage: 26:441/442 of query aligns to 50:466/466 of 6lpuA
- binding flavin-adenine dinucleotide: P75 (= P51), G77 (= G53), G78 (= G54), N79 (≠ L55), T80 (= T56), G81 (= G57), G85 (= G61), S86 (≠ A62), L139 (= L115), G140 (= G116), A141 (= A117), C145 (= C121), H146 (≠ Q122), G148 (= G124), G149 (= G125), N150 (= N126), A152 (= A128), T153 (= T129), A155 (= A131), E206 (= E182), G207 (= G183), I211 (= I187), I212 (= I188), E422 (= E397), N459 (= N434)
- binding (2s)-2-hydroxypentanedioic acid: R333 (= R308), T337 (≠ G310), K348 (≠ N321), Y379 (≠ F354), H381 (= H356), H388 (= H363), H423 (= H398)
- binding zinc ion: H381 (= H356), H388 (= H363), E422 (= E397)
Sites not aligning to the query:
6lpqA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-malate (d-mal) (see paper)
39% identity, 94% coverage: 26:441/442 of query aligns to 50:466/466 of 6lpqA
- binding flavin-adenine dinucleotide: P75 (= P51), G77 (= G53), G78 (= G54), N79 (≠ L55), T80 (= T56), G81 (= G57), G85 (= G61), S86 (≠ A62), L139 (= L115), G140 (= G116), A141 (= A117), C145 (= C121), H146 (≠ Q122), G149 (= G125), N150 (= N126), A152 (= A128), T153 (= T129), A155 (= A131), G157 (= G133), E206 (= E182), G207 (= G183), I211 (= I187), I212 (= I188), E422 (= E397), N459 (= N434)
- binding d-malate: M82 (≠ L58), R333 (= R308), T337 (≠ G310), K348 (≠ N321), Y379 (≠ F354), H381 (= H356), H388 (= H363), E422 (= E397), H423 (= H398)
- binding zinc ion: H381 (= H356), H388 (= H363), E422 (= E397)
Sites not aligning to the query:
6lppA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with d-2-hydroxyglutarate (d-2-hg) (see paper)
39% identity, 94% coverage: 26:441/442 of query aligns to 50:466/466 of 6lppA
- binding (2R)-2-hydroxypentanedioic acid: R333 (= R308), T337 (≠ G310), K348 (≠ N321), Y379 (≠ F354), H381 (= H356), H388 (= H363), N390 (≠ A365), H423 (= H398)
- binding flavin-adenine dinucleotide: P75 (= P51), G77 (= G53), G78 (= G54), N79 (≠ L55), T80 (= T56), G81 (= G57), M82 (≠ L58), G85 (= G61), S86 (≠ A62), L139 (= L115), G140 (= G116), A141 (= A117), C145 (= C121), G149 (= G125), N150 (= N126), A152 (= A128), T153 (= T129), A155 (= A131), G157 (= G133), G207 (= G183), I212 (= I188), E422 (= E397), H423 (= H398)
- binding zinc ion: H381 (= H356), H388 (= H363), E422 (= E397)
Sites not aligning to the query:
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
39% identity, 94% coverage: 26:441/442 of query aligns to 51:467/467 of 6lpnB
- binding flavin-adenine dinucleotide: P76 (= P51), G78 (= G53), G79 (= G54), N80 (≠ L55), T81 (= T56), G82 (= G57), M83 (≠ L58), G86 (= G61), S87 (≠ A62), L140 (= L115), A142 (= A117), C146 (= C121), H147 (≠ Q122), G150 (= G125), N151 (= N126), A153 (= A128), T154 (= T129), G208 (= G183), I212 (= I187), I213 (= I188), E423 (= E397), N460 (= N434)
Sites not aligning to the query:
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
39% identity, 94% coverage: 26:441/442 of query aligns to 103:519/521 of Q8N465
- S109 (≠ V32) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ V50) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G54) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ A70) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ L76) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ T95) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P112) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A128) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (= A154) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G156) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ S297) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R308) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ G310) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ L319) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (≠ N321) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (= R343) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (= A349) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H356) binding ; mutation to A: Loss of catalytic activity.
- G436 (= G358) to V: slight reduction in catalytic activity
- N439 (= N361) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H363) binding ; mutation to A: Loss of catalytic activity.
- N443 (≠ A365) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ F366) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ V368) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E397) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H398) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G399) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
32% identity, 98% coverage: 9:439/442 of query aligns to 62:496/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
30% identity, 99% coverage: 1:438/442 of query aligns to 23:463/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P51), G75 (= G53), S76 (≠ G54), G77 (≠ L55), T78 (= T56), G79 (= G57), L80 (= L58), A83 (≠ G61), C84 (≠ A62), P137 (≠ L115), G138 (= G116), E139 (≠ A117), A142 (≠ C121), T143 (≠ Q122), G146 (= G125), N147 (= N126), S149 (≠ A128), T150 (= T129), A152 (= A131), G153 (= G132), E203 (= E182), G204 (= G183), I209 (= I188), E422 (= E397), H423 (= H398)
- binding fe (iii) ion: H377 (= H356), H384 (= H363), E422 (= E397)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 100% coverage: 1:440/442 of query aligns to 17:457/459 of P9WIT1
- K354 (≠ R333) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
30% identity, 99% coverage: 3:439/442 of query aligns to 20:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R308), W322 (≠ A312), H369 (= H356), H376 (= H363), H414 (= H398)
- binding flavin-adenine dinucleotide: P68 (= P51), G70 (= G53), T71 (≠ G54), G72 (≠ L55), T73 (= T56), G74 (= G57), G78 (= G61), V79 (≠ A62), L90 (= L73), P132 (≠ L115), G133 (= G116), A134 (= A117), G140 (= G125), M141 (≠ N126), A143 (= A128), T144 (= T129), A146 (= A131), S147 (≠ G132), E200 (= E182), G201 (= G183), I206 (= I188), W322 (≠ A312), E413 (= E397), N450 (= N434)
- binding manganese (ii) ion: H369 (= H356), H376 (= H363), E413 (= E397)
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
30% identity, 99% coverage: 3:439/442 of query aligns to 20:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E32 (≠ A15), P68 (= P51), G70 (= G53), T71 (≠ G54), G72 (≠ L55), T73 (= T56), G74 (= G57), G78 (= G61), V79 (≠ A62), L90 (= L73), P132 (≠ L115), G133 (= G116), A134 (= A117), G140 (= G125), M141 (≠ N126), A143 (= A128), T144 (= T129), A146 (= A131), S147 (≠ G132), E200 (= E182), G201 (= G183), I206 (= I188), W323 (≠ A312), E414 (= E397), H415 (= H398), N451 (= N434)
- binding manganese (ii) ion: H370 (= H356), H377 (= H363), E414 (= E397)
- binding pyruvic acid: R319 (= R308), H370 (= H356), H377 (= H363), H415 (= H398)
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
31% identity, 99% coverage: 3:439/442 of query aligns to 20:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L58), R317 (= R308), W321 (≠ A312), H368 (= H356), H375 (= H363), H413 (= H398)
- binding flavin-adenine dinucleotide: P68 (= P51), G70 (= G53), T71 (≠ G54), G72 (≠ L55), T73 (= T56), G74 (= G57), G78 (= G61), V79 (≠ A62), L90 (= L73), P132 (≠ L115), G133 (= G116), A134 (= A117), G140 (= G125), M141 (≠ N126), A143 (= A128), T144 (= T129), A146 (= A131), S147 (≠ G132), E200 (= E182), G201 (= G183), I206 (= I188), W321 (≠ A312), Y322 (≠ L313), E412 (= E397), H413 (= H398), N449 (= N434)
- binding manganese (ii) ion: H368 (= H356), H375 (= H363), E412 (= E397)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
31% identity, 99% coverage: 3:439/442 of query aligns to 20:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E32 (≠ A15), P68 (= P51), G70 (= G53), T71 (≠ G54), G72 (≠ L55), T73 (= T56), G74 (= G57), G78 (= G61), V79 (≠ A62), L90 (= L73), P132 (≠ L115), G133 (= G116), A134 (= A117), G140 (= G125), M141 (≠ N126), A143 (= A128), T144 (= T129), A146 (= A131), S147 (≠ G132), E200 (= E182), G201 (= G183), I206 (= I188), W322 (≠ A312), E413 (= E397), H414 (= H398), N450 (= N434)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R308), H369 (= H356), H376 (= H363), H414 (= H398)
- binding manganese (ii) ion: H369 (= H356), H376 (= H363), E413 (= E397)
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
31% identity, 99% coverage: 3:439/442 of query aligns to 20:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R308), W322 (≠ A312), H369 (= H356), H376 (= H363), H413 (= H398)
- binding flavin-adenine dinucleotide: E32 (≠ A15), P68 (= P51), G70 (= G53), T71 (≠ G54), G72 (≠ L55), T73 (= T56), G74 (= G57), G78 (= G61), V79 (≠ A62), L90 (= L73), P132 (≠ L115), G133 (= G116), A134 (= A117), G140 (= G125), M141 (≠ N126), A143 (= A128), T144 (= T129), A146 (= A131), S147 (≠ G132), E200 (= E182), G201 (= G183), I206 (= I188), W322 (≠ A312), E412 (= E397), H413 (= H398), N449 (= N434)
- binding manganese (ii) ion: H369 (= H356), H376 (= H363), E412 (= E397)
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
31% identity, 99% coverage: 3:439/442 of query aligns to 20:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R308), W322 (≠ A312), S336 (≠ N321), H369 (= H356), H376 (= H363), H413 (= H398)
- binding flavin-adenine dinucleotide: P68 (= P51), G70 (= G53), T71 (≠ G54), G72 (≠ L55), T73 (= T56), G74 (= G57), G78 (= G61), V79 (≠ A62), L90 (= L73), P132 (≠ L115), G133 (= G116), A134 (= A117), G140 (= G125), M141 (≠ N126), A143 (= A128), T144 (= T129), A146 (= A131), S147 (≠ G132), E200 (= E182), G201 (= G183), I206 (= I188), E412 (= E397), N449 (= N434)
- binding manganese (ii) ion: H369 (= H356), H376 (= H363), E412 (= E397)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
31% identity, 99% coverage: 3:439/442 of query aligns to 20:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R308), H369 (= H356), H376 (= H363), H414 (= H398)
- binding flavin-adenine dinucleotide: P68 (= P51), G70 (= G53), T71 (≠ G54), G72 (≠ L55), T73 (= T56), G74 (= G57), G78 (= G61), V79 (≠ A62), L90 (= L73), P132 (≠ L115), G133 (= G116), A134 (= A117), G140 (= G125), M141 (≠ N126), A143 (= A128), T144 (= T129), A146 (= A131), S147 (≠ G132), E200 (= E182), G201 (= G183), I206 (= I188), W322 (≠ A312), E413 (= E397), H414 (= H398), N450 (= N434)
- binding manganese (ii) ion: H369 (= H356), H376 (= H363), E413 (= E397)
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
31% identity, 99% coverage: 3:439/442 of query aligns to 20:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P51), G70 (= G53), T71 (≠ G54), G72 (≠ L55), T73 (= T56), G74 (= G57), G78 (= G61), V79 (≠ A62), L90 (= L73), P132 (≠ L115), G133 (= G116), A134 (= A117), G140 (= G125), M141 (≠ N126), A143 (= A128), T144 (= T129), A146 (= A131), S147 (≠ G132), E200 (= E182), G201 (= G183), I206 (= I188), W322 (≠ A312), E413 (= E397), H414 (= H398), N450 (= N434)
- binding lactic acid: R318 (= R308), H369 (= H356), H376 (= H363), H414 (= H398)
- binding manganese (ii) ion: H369 (= H356), H376 (= H363), E413 (= E397)
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
30% identity, 99% coverage: 3:439/442 of query aligns to 20:455/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (= P51), G70 (= G53), T71 (≠ G54), G72 (≠ L55), T73 (= T56), G74 (= G57), G78 (= G61), V79 (≠ A62), L90 (= L73), P132 (≠ L115), G133 (= G116), A134 (= A117), G140 (= G125), M141 (≠ N126), A143 (= A128), T144 (= T129), A146 (= A131), S147 (≠ G132), E200 (= E182), G201 (= G183), I206 (= I188), H369 (= H356), E413 (= E397), N450 (= N434)
- binding deaminohydroxyvaline: R319 (= R308), H414 (= H398)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
30% identity, 99% coverage: 3:439/442 of query aligns to 20:456/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P51), G70 (= G53), T71 (≠ G54), G72 (≠ L55), T73 (= T56), G74 (= G57), G78 (= G61), V79 (≠ A62), L90 (= L73), P132 (≠ L115), G133 (= G116), A134 (= A117), G140 (= G125), M141 (≠ N126), A143 (= A128), T144 (= T129), A146 (= A131), S147 (≠ G132), E200 (= E182), G201 (= G183), I206 (= I188), Y324 (≠ L313), H370 (= H356), E414 (= E397), N451 (= N434)
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: R319 (= R308), W323 (≠ A312), H415 (= H398)
Query Sequence
>SM_b21129 FitnessBrowser__Smeli:SM_b21129
MLTGDRIAERHRGDASLTGRILPLAVVRPASVAEVADALRICNAHRQAVVPQGGLTGLAG
GANPCAGDVAISLERLSGIEEIDAAAGTMTVLAGTPLEVAQRAAEDAGFLLPIDLGARGS
CQVGGNLATNAGGIRVIRNGVARDNVLGLEAVLADGTVLSSMNKMIKNNTGYDLRQLFIG
SEGTLGIITRAVLRLRPLPAGRLTALCALDSYENVVALLKRAQKELAGLSAYEAMWESYF
RFNCVAEGLRLFEATPAFAVIVEEDLQGHEAERERFEAFLGRALEDGVIGDALIAQSQKE
VQTFWRIREGHALDRLPLLLNFDVSLPIGEIGRFADECGKALRAKFPEAHVSFFGHVGDS
NLHIAFSVPGATEETAHAVDAVVYGLVGIYSGSVSAEHGIGLVKRDFLDRSRSPAELELM
RRIKNALDPNGILNPGKVLGSI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory