Comparing SM_b21135 FitnessBrowser__Smeli:SM_b21135 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
33% identity, 85% coverage: 28:264/280 of query aligns to 1:228/229 of 5t0wA
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
32% identity, 83% coverage: 36:266/280 of query aligns to 3:225/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
31% identity, 82% coverage: 36:265/280 of query aligns to 3:226/226 of 4zv1A
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
27% identity, 85% coverage: 30:266/280 of query aligns to 3:229/229 of 6svfA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
31% identity, 74% coverage: 59:264/280 of query aligns to 36:234/243 of 5eyfB
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
28% identity, 82% coverage: 29:258/280 of query aligns to 2:227/231 of 2v25A
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
29% identity, 75% coverage: 33:241/280 of query aligns to 7:211/247 of 2yjpA
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
29% identity, 81% coverage: 38:265/280 of query aligns to 4:222/226 of 8eyzA
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
27% identity, 81% coverage: 39:264/280 of query aligns to 8:227/228 of 2y7iA
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
26% identity, 86% coverage: 28:268/280 of query aligns to 5:242/251 of 1xt8B
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
26% identity, 81% coverage: 37:264/280 of query aligns to 1:222/224 of 4ymxA
4h5fA Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l- arginine, form 1
29% identity, 66% coverage: 28:211/280 of query aligns to 2:183/240 of 4h5fA
2vhaA Debp (see paper)
24% identity, 91% coverage: 23:278/280 of query aligns to 1:259/276 of 2vhaA
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
24% identity, 91% coverage: 23:278/280 of query aligns to 2:260/278 of 2ia4B
5kkwA Crystal structure of sar11_1068 bound to a sulfobetaine (3-(1- methylpiperidinium-1-yl)propane-1-sulfonate)
31% identity, 76% coverage: 28:241/280 of query aligns to 2:212/237 of 5kkwA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
27% identity, 82% coverage: 36:264/280 of query aligns to 3:226/234 of 3k4uE
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
28% identity, 79% coverage: 41:260/280 of query aligns to 30:252/260 of P02910
Sites not aligning to the query:
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
28% identity, 79% coverage: 41:260/280 of query aligns to 8:230/238 of 1hslA
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
29% identity, 79% coverage: 41:260/280 of query aligns to 30:252/260 of P02911
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
29% identity, 79% coverage: 41:260/280 of query aligns to 8:230/238 of 1lstA
>SM_b21135 FitnessBrowser__Smeli:SM_b21135
MISRFTVAASFVAAVLAAMPAQAQQASSKLDEVLSRGHLILGTGSTNAPWHFKSAEDKLQ
GFDVDMGRIIAKALFGDPEKIEFVNQSSDARIPNITTGKVDITCQFMTVTGERAQQIAFT
IPYYREGVGLMLKADGKYADYEALKAAGSSVTISVLQNVYAEDMVHAALPEATVDQYESV
DLIYQALESGRADAAATDQSSLAWYMTQNSGRYKDAGYGWNPQTYACGVRRGDQDWLNFV
NTALHEAMTGVEFDFYAKSFKTWFGKDLTPPHIGFPIEYK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory