Comparing SM_b21214 FitnessBrowser__Smeli:SM_b21214 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3s6jE The crystal structure of a hydrolase from pseudomonas syringae
32% identity, 74% coverage: 30:206/240 of query aligns to 3:191/220 of 3s6jE
2qltA Crystal structure of an isoform of dl-glycerol-3-phosphatase, rhr2p, from saccharomyces cerevisiae
32% identity, 64% coverage: 31:184/240 of query aligns to 15:180/251 of 2qltA
P41277 Glycerol-1-phosphate phosphohydrolase 1; (DL)-glycerol-3-phosphatase 1; Related to HOR2 protein 2; EC 3.1.3.21 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
32% identity, 64% coverage: 31:184/240 of query aligns to 14:179/250 of P41277
Sites not aligning to the query:
3qypB Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, glu47asn mutant complexed with calcium and phosphate (see paper)
33% identity, 74% coverage: 27:204/240 of query aligns to 7:197/228 of 3qypB
3qu2A Crystal structure of pyrophosphatase from bacteroides thetaiotaomicron, a closed cap conformation (see paper)
33% identity, 73% coverage: 31:204/240 of query aligns to 4:190/221 of 3qu2A
3dv9A Putative beta-phosphoglucomutase from bacteroides vulgatus.
31% identity, 74% coverage: 28:204/240 of query aligns to 22:208/243 of 3dv9A
Q8VZ10 Protein SUPPRESSOR OF QUENCHING 1, chloroplastic; EC 3.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 69% coverage: 30:195/240 of query aligns to 75:253/1055 of Q8VZ10
Sites not aligning to the query:
Q9HZ62 N-acetylmuramic acid 6-phosphate phosphatase; MurNAc 6-phosphate phosphatase; MurNAc-6P phosphatase; EC 3.1.3.105 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
26% identity, 78% coverage: 28:213/240 of query aligns to 5:200/226 of Q9HZ62
4eenA Crystal structure of had family hydrolase dr_1622 from deinococcus radiodurans r1 (target efi-501256) with bound magnesium
29% identity, 65% coverage: 29:185/240 of query aligns to 4:170/229 of 4eenA
4c4sA Structure of beta-phosphoglucomutase in complex with an alpha- fluorophosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride (see paper)
28% identity, 70% coverage: 29:197/240 of query aligns to 2:180/215 of 4c4sA
7ocpA NADPH bound to the dehydrogenase domain of the bifunctional mannitol- 1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
26% identity, 68% coverage: 33:195/240 of query aligns to 13:186/688 of 7ocpA
Sites not aligning to the query:
7ocnA Crystal structure of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
26% identity, 68% coverage: 33:195/240 of query aligns to 13:186/690 of 7ocnA
7ocqA Nadh bound to the dehydrogenase domain of the bifunctional mannitol-1- phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
26% identity, 68% coverage: 33:195/240 of query aligns to 13:186/686 of 7ocqA
Sites not aligning to the query:
7ocqB Nadh bound to the dehydrogenase domain of the bifunctional mannitol-1- phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
28% identity, 68% coverage: 33:195/240 of query aligns to 13:181/679 of 7ocqB
Sites not aligning to the query:
7ocrB NADPH and fructose-6-phosphate bound to the dehydrogenase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
27% identity, 68% coverage: 33:195/240 of query aligns to 13:180/675 of 7ocrB
Sites not aligning to the query:
5olwA 5-fluorotryptophan labeled beta-phosphoglucomutase in an open conformation (see paper)
26% identity, 70% coverage: 29:197/240 of query aligns to 2:183/224 of 5olwA
7ocsC Mannitol-1-phosphate bound to the phosphatase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld-d16a from acinetobacter baumannii (see paper)
32% identity, 49% coverage: 79:195/240 of query aligns to 65:186/572 of 7ocsC
Sites not aligning to the query:
6w04A Crystal structure of had hydrolase, family ia, variant 3 from entamoeba histolytica hm-1:imss
24% identity, 70% coverage: 31:197/240 of query aligns to 3:182/223 of 6w04A
2wf9A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, and beryllium trifluoride, crystal form 2 (see paper)
26% identity, 70% coverage: 29:197/240 of query aligns to 2:183/221 of 2wf9A
1o03A Structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 6-phosphate (see paper)
26% identity, 70% coverage: 29:197/240 of query aligns to 2:183/221 of 1o03A
>SM_b21214 FitnessBrowser__Smeli:SM_b21214
MCRPAKHVNSKSKGPGLDTSSSAIFTKNFAALLFDMDGTLLNSMAVVERVWGSWALRNGI
DPVALMKIVHGVRAVDTIRALGLPVDPEQEARILAEAEIADVEGIVEIPGAVSFLKTLPP
ERWAIVTSAPLELAARRLEAAGIPVPRHMVTGEDVSVGKPDPQGYLLAAQRLGVRAEDCL
VFEDAPAGVLAGKSAGAEVAVITGAHAAAAEMPHIMLSHYSDVEARLVEDGWLSLHRRRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory