Comparing SM_b21217 FitnessBrowser__Smeli:SM_b21217 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
29% identity, 93% coverage: 6:295/311 of query aligns to 6:291/312 of 3in1A
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
26% identity, 95% coverage: 3:297/311 of query aligns to 4:302/313 of 6ilsB
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 95% coverage: 3:297/311 of query aligns to 70:368/379 of A1A6H3
Sites not aligning to the query:
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
28% identity, 94% coverage: 16:307/311 of query aligns to 14:298/301 of 1v1aA
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
28% identity, 94% coverage: 16:307/311 of query aligns to 14:298/300 of 1v1bA
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
28% identity, 94% coverage: 16:307/311 of query aligns to 14:298/309 of Q53W83
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
25% identity, 90% coverage: 1:281/311 of query aligns to 1:273/306 of 4xckA
Sites not aligning to the query:
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
27% identity, 88% coverage: 4:276/311 of query aligns to 7:271/309 of P0A9J6
Sites not aligning to the query:
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
27% identity, 88% coverage: 4:276/311 of query aligns to 4:268/305 of 1rk2A
Sites not aligning to the query:
1gqtB Activation of ribokinase by monovalent cations (see paper)
27% identity, 88% coverage: 4:276/311 of query aligns to 6:270/307 of 1gqtB
Sites not aligning to the query:
3kd6A Crystal structure of nucleoside kinase from chlorobium tepidum in complex with amp
29% identity, 41% coverage: 170:298/311 of query aligns to 149:281/300 of 3kd6A
Sites not aligning to the query:
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
49% identity, 16% coverage: 223:273/311 of query aligns to 219:268/312 of 4wjmA
Sites not aligning to the query:
3otxA Crystal structure of trypanosoma brucei rhodesiense adenosine kinase complexed with inhibitor ap5a (see paper)
37% identity, 24% coverage: 223:297/311 of query aligns to 257:333/338 of 3otxA
Sites not aligning to the query:
6wb7A Acarbose kinase acbk as a complex with acarbose and amp-pnp (see paper)
39% identity, 23% coverage: 223:295/311 of query aligns to 206:280/296 of 6wb7A
Sites not aligning to the query:
6wb7C Acarbose kinase acbk as a complex with acarbose and amp-pnp (see paper)
39% identity, 23% coverage: 223:295/311 of query aligns to 205:279/293 of 6wb7C
Sites not aligning to the query:
6ul7A Structure of human ketohexokinasE-C in complex with fructose, no3, and osthole
22% identity, 93% coverage: 2:289/311 of query aligns to 3:286/297 of 6ul7A
Sites not aligning to the query:
8ug1B Crystal structure of khk-c and compound 13 (see paper)
30% identity, 32% coverage: 192:289/311 of query aligns to 196:294/305 of 8ug1B
Sites not aligning to the query:
8ug3A Crystal structure of khk-c and compound 23 (see paper)
30% identity, 32% coverage: 192:289/311 of query aligns to 189:287/298 of 8ug3A
Sites not aligning to the query:
8omkA Hkhk-c in complex with adp & fructose 1-phosphate
30% identity, 32% coverage: 192:289/311 of query aligns to 189:287/298 of 8omkA
Sites not aligning to the query:
3qa2A X-ray structure of ketohexokinase in complex with a pyrimidopyrimidine analog 2 (see paper)
30% identity, 32% coverage: 192:289/311 of query aligns to 188:286/297 of 3qa2A
>SM_b21217 FitnessBrowser__Smeli:SM_b21217
MRPLAAIGNVNVDLILGPAEPWPKPGTEVIVDHDELRVGGCAGNNALAWDSLGVDYVIAA
NVGNDQFGTWLKEAFGERSRNWPVEAVGTTLSVGITHPDGERTFFTTRGHLPLFSFPEVH
SMLDGNRLRGGYALLSGSFLTDALTLAYDALFDWADAHEIAVALDTGWPLDGWTETNRLR
TLGWLKRCHCALFNEVETTTLTGLSDPAEAALSLKGEMPAEAIVVVKRGPHGALAIDRDG
GTFSVPAPQVQVVDTIGAGDVFNAGFLAALAAEMPLEACLKTGVTIASEAISTLPRRYGK
PLSAFLEESRR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory