Comparing SM_b21218 FitnessBrowser__Smeli:SM_b21218 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; D-fructose-6-phosphate amidotransferase 1; Glutamine:fructose-6-phosphate amidotransferase 1; GFAT 1; GFAT1; Hexosephosphate aminotransferase 1; EC 2.6.1.16 from Homo sapiens (Human) (see paper)
23% identity, 81% coverage: 43:318/339 of query aligns to 381:676/699 of Q06210
2zj4A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
23% identity, 81% coverage: 43:318/339 of query aligns to 47:342/365 of 2zj4A
Sites not aligning to the query:
2zj3A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
23% identity, 81% coverage: 43:318/339 of query aligns to 47:342/365 of 2zj3A
Sites not aligning to the query:
6r4gA Crystal structure of human gfat-1 in complex with udp-glcnac (see paper)
23% identity, 81% coverage: 43:318/339 of query aligns to 341:636/652 of 6r4gA
Sites not aligning to the query:
6svmA Crystal structure of human gfat-1 in complex with glucose-6-phosphate, l-glu, and udp-galnac (see paper)
23% identity, 81% coverage: 43:318/339 of query aligns to 342:637/660 of 6svmA
Sites not aligning to the query:
6r4eA Crystal structure of human gfat-1 in complex with glucose-6-phosphate and l-glu (see paper)
23% identity, 81% coverage: 43:318/339 of query aligns to 345:640/663 of 6r4eA
Sites not aligning to the query:
2v4mA The isomerase domain of human glutamine-fructose-6-phosphate transaminase 1 (gfpt1) in complex with fructose 6-phosphate
23% identity, 81% coverage: 43:318/339 of query aligns to 46:341/352 of 2v4mA
8fdbA Crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate at 3.06 a resolution. (see paper)
25% identity, 60% coverage: 49:250/339 of query aligns to 43:255/332 of 8fdbA
8fdbB Crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate at 3.06 a resolution. (see paper)
25% identity, 60% coverage: 49:250/339 of query aligns to 44:256/333 of 8fdbB
8eymA Crystal structure of nagb-ii phosphosugar isomerase from shewanella denitrificans os217 in complex with glucitolamine-6-phosphate and n- acetylglucosamine-6-phosphate at 2.31 a resolution (see paper)
25% identity, 60% coverage: 49:250/339 of query aligns to 42:254/319 of 8eymA
>SM_b21218 FitnessBrowser__Smeli:SM_b21218
MSISKDRPAGLIAIDREMARQHADAIASYEGATATAQRIAASLKSTGRLLLLGMGGSHAV
GRAVEPLYRALGIEAVAVPLSEQLGEPLSIEGKTILVTSQSGESAEVLRWFRETDGGTSE
TFGLTLEEDAFLAKAVPSLVGSGGTERAFAATRSLTVTFALHLAVLAALGADPADALRAL
RDPEAPVIDGALAALADVGAIVTSGRKLQGLAEAIALGLTELSRLPCFSLEGGQLRHGPM
EMLGASVGVVLFRAADPTAKLVGAMATSAAEAGSPVIVFDASDESPAAGATTIRFKPAAG
LAAILAMLPVAQSLMIAFADARVENAGTPVRSTKVTRSE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory