Comparing SM_b21220 SM_b21220 sugar ABC transporter permease to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
34% identity, 96% coverage: 10:290/293 of query aligns to 10:283/285 of 7cagA
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
30% identity, 78% coverage: 51:279/293 of query aligns to 245:487/490 of 4ki0F
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
30% identity, 78% coverage: 51:279/293 of query aligns to 260:502/514 of P02916
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
25% identity, 88% coverage: 11:268/293 of query aligns to 33:288/313 of P94529
>SM_b21220 SM_b21220 sugar ABC transporter permease
MTGTWISTRAWLLMLPLLVVMTAVIGWPLVDTVRLSFTDAKLVGTEGGFVGTANYIKMLG
GSNFQRALVTTTWFAVISVAAEMVLGVLAALLLNQQFRGRTALRALMILPWALPTVVNAT
LWRLIYNPEYGALNAALTQLGLLDSYRSWLGEPGTALAALIVADCWKNFPLVALIALAAL
QAVPRDITAASLVDGAGPFNRFRFVIMPYLAGPLLVALVLRTIEAFKVFDIIWVMTRGGP
ANSTRTLSILVYQEAFSFQRAGSGASLALIVTLLVTILAAAYAALLRKAAGAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory