SitesBLAST
Comparing SM_b21338 FitnessBrowser__Smeli:SM_b21338 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
5g5gB Escherichia coli periplasmic aldehyde oxidase (see paper)
64% identity, 94% coverage: 1:283/301 of query aligns to 1:279/316 of 5g5gB
- binding flavin-adenine dinucleotide: K26 (≠ R26), F27 (= F27), A29 (= A29), G30 (= G30), G31 (= G31), T32 (= T32), N33 (= N33), L34 (= L34), G98 (= G98), A99 (= A99), L103 (≠ I103), A107 (= A107), T108 (≠ S108), A110 (≠ G110), G111 (= G111), N112 (= N112), L114 (= L114), Q115 (= Q115), S163 (= S163), D164 (= D164), L212 (≠ M212), I213 (= I213), F239 (= F239)
- binding iron/sulfur cluster: C119 (= C119), C129 (= C129), N130 (= N130), K131 (= K131), C138 (= C138), H148 (= H148), C157 (= C157), I158 (= I158), A159 (= A159)
P77324 Aldehyde oxidoreductase FAD-binding subunit PaoB; EC 1.2.99.6 from Escherichia coli (strain K12) (see paper)
64% identity, 94% coverage: 1:283/301 of query aligns to 1:279/318 of P77324
- 26:34 (vs. 26:34, 89% identical) binding
- T108 (≠ S108) binding
- C119 (= C119) binding
- C129 (= C129) binding
- C138 (= C138) binding
- C157 (= C157) binding
- D164 (= D164) binding
- I213 (= I213) binding
- K230 (= K230) binding
5y6qB Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
43% identity, 98% coverage: 1:294/301 of query aligns to 1:296/330 of 5y6qB
- binding flavin-adenine dinucleotide: I26 (≠ F27), A28 (= A29), G29 (= G30), G30 (= G31), T31 (= T32), T32 (≠ N33), Q33 (≠ L34), A97 (≠ G98), A98 (= A99), I102 (= I103), A106 (= A107), T107 (≠ S108), G110 (= G111), N111 (= N112), R113 (≠ L114), Q114 (= Q115), G164 (≠ S163), D165 (= D164), I213 (≠ M212), I214 (= I213), K232 (= K230), F241 (= F239)
- binding iron/sulfur cluster: C118 (= C119), Y121 (≠ F122), C130 (= C129), N131 (= N130), C139 (= C138), A141 (= A140), C158 (= C157), I159 (= I158), A160 (= A159)
1rm6B Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
36% identity, 89% coverage: 1:269/301 of query aligns to 4:263/323 of 1rm6B
- binding flavin-adenine dinucleotide: P29 (≠ F27), G31 (≠ A29), A32 (≠ G30), G33 (= G31), T34 (= T32), D35 (≠ N33), L36 (= L34), L53 (≠ I51), V101 (≠ G98), A102 (= A99), A110 (= A107), T111 (≠ S108), G114 (= G111), N115 (= N112), C117 (≠ L114), Q118 (= Q115), D162 (= D164), L207 (≠ I213), V231 (≠ Y237), D232 (≠ A238), F233 (= F239)
- binding iron/sulfur cluster: C122 (= C119), F124 (= F122), C138 (= C138), C146 (≠ M147), H147 (= H148), V148 (= V150), C155 (= C157), Y156 (≠ I158), A157 (= A159)
O33820 4-hydroxybenzoyl-CoA reductase subunit beta; 4-HBCR subunit beta; EC 1.1.7.1 from Thauera aromatica (see paper)
36% identity, 89% coverage: 1:269/301 of query aligns to 4:263/324 of O33820
- 29:36 (vs. 27:34, 38% identical) binding
- T111 (≠ S108) binding
- N115 (= N112) binding
- Q118 (= Q115) binding
- D162 (= D164) binding
- K224 (= K230) binding
1ffuC Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
29% identity, 88% coverage: 4:267/301 of query aligns to 6:221/287 of 1ffuC
- binding flavin-adenine dinucleotide: K29 (≠ R26), L30 (≠ F27), A32 (= A29), G33 (= G30), G34 (= G31), H35 (≠ T32), S36 (≠ N33), L37 (= L34), I54 (= I51), I101 (≠ G98), A102 (= A99), G110 (≠ A107), T111 (≠ S108), G114 (= G111), D115 (≠ N112), A117 (≠ L114), N123 (≠ A136), D124 (≠ G137), L161 (= L207), V166 (≠ M212), M167 (≠ I213), W193 (≠ F239)
1t3qC Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
26% identity, 94% coverage: 4:287/301 of query aligns to 6:238/285 of 1t3qC
- binding flavin-adenine dinucleotide: I29 (≠ F27), A31 (= A29), G32 (= G30), G33 (= G31), Q34 (≠ T32), S35 (≠ N33), L36 (= L34), V100 (≠ G98), A101 (= A99), V105 (≠ I103), T110 (≠ S108), G113 (= G111), S114 (≠ N112), A116 (≠ M147), A122 (≠ S163), E123 (≠ D164), L166 (≠ I213), Y190 (= Y237)
1n5wC Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
28% identity, 99% coverage: 4:301/301 of query aligns to 6:253/287 of 1n5wC
P19920 Carbon monoxide dehydrogenase medium chain; CO dehydrogenase subunit M; CO-DH M; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
28% identity, 99% coverage: 4:301/301 of query aligns to 6:253/288 of P19920
7dqxE Crystal structure of xanthine dehydrogenase family protein
28% identity, 95% coverage: 1:287/301 of query aligns to 1:242/293 of 7dqxE
- binding flavin-adenine dinucleotide: K29 (≠ R26), I30 (≠ F27), I31 (= I28), G33 (= G30), G34 (= G31), Q35 (≠ T32), S36 (≠ N33), L37 (= L34), H78 (≠ N75), I101 (≠ G98), A102 (= A99), I106 (= I103), G110 (≠ A107), T111 (≠ S108), G113 (= G110), G114 (= G111), S115 (≠ N112), A117 (≠ L114), A123 (= A140), E124 (≠ D164), I167 (= I213), Y193 (≠ F239)
4zohB Crystal structure of glyceraldehyde oxidoreductase (see paper)
25% identity, 99% coverage: 4:300/301 of query aligns to 6:247/274 of 4zohB
- binding flavin-adenine dinucleotide: R28 (= R26), P29 (≠ F27), A31 (= A29), G32 (= G30), G33 (= G31), H34 (≠ T32), S35 (≠ N33), L36 (= L34), H77 (≠ N75), I95 (≠ G98), G96 (≠ A99), V100 (≠ I103), T105 (≠ S108), G108 (= G111), S109 (≠ N112), S111 (≠ N130), A117 (= A136), D118 (= D164), L160 (≠ M212), V161 (≠ I213), D185 (≠ A238), F186 (= F239)
Sites not aligning to the query:
Q0QLF4 Nicotinate dehydrogenase FAD-subunit; NDH; Nicotinic acid hydroxylase FAD-subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
26% identity, 95% coverage: 1:285/301 of query aligns to 1:243/296 of Q0QLF4
- 29:36 (vs. 27:34, 75% identical) binding
- G101 (≠ A99) binding
- TIGGN 110:114 (≠ STGGN 108:112) binding
- D123 (= D164) binding
- R160 (≠ E204) binding
- M169 (≠ I213) binding
- K187 (= K230) binding
3hrdG Crystal structure of nicotinate dehydrogenase (see paper)
26% identity, 95% coverage: 1:285/301 of query aligns to 1:243/292 of 3hrdG
- binding flavin-adenine dinucleotide: I29 (≠ F27), A31 (= A29), G32 (= G30), G33 (= G31), T34 (= T32), D35 (≠ N33), F77 (≠ N75), V100 (≠ G98), G101 (≠ A99), I105 (= I103), T110 (≠ S108), G113 (= G111), N114 (= N112), S116 (= S154), T117 (≠ Q155), G122 (≠ S163), D123 (= D164), I168 (≠ M212), M169 (≠ I213)
2w54A Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus in complex with bound inhibitor pterin-6-aldehyde (see paper)
27% identity, 90% coverage: 23:292/301 of query aligns to 185:402/450 of 2w54A
- binding flavin-adenine dinucleotide: L189 (≠ F27), A191 (= A29), G192 (= G30), G193 (= G31), T194 (= T32), D195 (≠ N33), V196 (≠ L34), W199 (≠ D36), L213 (vs. gap), F258 (≠ G98), A259 (= A99), A267 (= A107), T268 (≠ S108), G271 (= G111), N272 (= N112), A274 (≠ C129), N275 (= N130), G280 (= G135), D281 (≠ A136), R318 (≠ L207), V324 (≠ I213), Q347 (≠ Y237)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 42
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 42, 44, 45, 47, 63, 103, 104, 106, 134, 135, 136
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: 102, 136
1jroA Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus (see paper)
27% identity, 90% coverage: 23:292/301 of query aligns to 185:402/450 of 1jroA
- binding flavin-adenine dinucleotide: L189 (≠ F27), A191 (= A29), G192 (= G30), G193 (= G31), T194 (= T32), D195 (≠ N33), V196 (≠ L34), F258 (≠ G98), A259 (= A99), T268 (≠ S108), G271 (= G111), N272 (= N112), A274 (≠ C129), G280 (= G135), D281 (≠ A136), R318 (≠ L207), V324 (≠ I213)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 42, 43
- binding fe2/s2 (inorganic) cluster: 37, 38, 39, 40, 42, 44, 45, 47, 63, 103, 106, 134, 136
Query Sequence
>SM_b21338 FitnessBrowser__Smeli:SM_b21338
MQPFSYQRADTVETAVAAVAGRPAARFIAGGTNLLDLMKLGIERPEHLVDIGRLGLDRIE
PTEEGGLHIGAQVRNSDLAADPIVRSRYPALSQALLAGASGQIRNKASTGGNLLQRTRCP
YFYNRNMPCNKREPGAGCAALRGFNRMHAVIGTSQACIAVHPSDMAVAMAVLDANVETVS
PGGETRSIPIGDLYRLPGTTPHQETVLAHGEMITGVTLPPPPAGRQAYRKVRDRASYAFA
LVSVAAIIEVSGNRVRTARVALGGVAPKPWRALETESRLAGAALSDNVLTDAAEAALAGA
V
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory