Comparing SM_b21344 FitnessBrowser__Smeli:SM_b21344 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
42% identity, 99% coverage: 2:491/497 of query aligns to 4:490/501 of P04983
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 49% coverage: 2:244/497 of query aligns to 17:256/378 of P69874
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 43% coverage: 2:217/497 of query aligns to 2:215/241 of 4u00A
7mdyC Lolcde nucleotide-bound
33% identity, 45% coverage: 1:222/497 of query aligns to 1:226/226 of 7mdyC
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
32% identity, 45% coverage: 1:222/497 of query aligns to 4:229/233 of P75957
7arlD Lolcde in complex with lipoprotein and adp (see paper)
33% identity, 44% coverage: 1:218/497 of query aligns to 1:222/222 of 7arlD
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 44% coverage: 2:218/497 of query aligns to 4:230/254 of 1g6hA
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
32% identity, 45% coverage: 1:222/497 of query aligns to 3:228/229 of 7v8iD
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 44% coverage: 2:218/497 of query aligns to 4:230/253 of 1g9xB
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
27% identity, 43% coverage: 2:217/497 of query aligns to 1:215/240 of 4ymuJ
Q5SSE9 ATP-binding cassette sub-family A member 13; EC 7.6.2.- from Mus musculus (Mouse) (see paper)
32% identity, 40% coverage: 17:214/497 of query aligns to 4711:4907/5034 of Q5SSE9
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 45% coverage: 270:491/497 of query aligns to 20:232/393 of P9WQI3
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
26% identity, 48% coverage: 2:239/497 of query aligns to 4:231/285 of 4yerA
3c4jA Abc protein artp in complex with atp-gamma-s
26% identity, 45% coverage: 2:225/497 of query aligns to 3:225/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
26% identity, 45% coverage: 2:225/497 of query aligns to 3:225/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
26% identity, 45% coverage: 2:225/497 of query aligns to 3:225/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
26% identity, 45% coverage: 2:225/497 of query aligns to 3:225/242 of 2oljA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
27% identity, 48% coverage: 2:239/497 of query aligns to 1:245/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
27% identity, 48% coverage: 2:239/497 of query aligns to 2:246/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
27% identity, 48% coverage: 2:239/497 of query aligns to 2:246/344 of 3tuiC
>SM_b21344 FitnessBrowser__Smeli:SM_b21344
MLLSMQGICKSFNGIPALRAASLEVGEAEVMALVGQNGAGKSTLIKILTGAYRRDEGAVV
FAGEGVSFSMPAESQARGIATIYQEINLAPQRSVAENIYLSREPRRFGLIDRRAMRDGAA
AVLRAFNLEIDVDQPVAGFSAATRQMVAIARAVTQKARLVIMDEPTSSLDEREVGILFDT
IRTLKRGGVSVVFIGHRLEELYRICDRVTIMRDGKTVATAAMADMPKLALVRHMLGKELA
AFEAIAKDADEGAQRPVRLSVRNAGAGVRVRDVSLTVREGEISGLAGLLGSGRTETANLI
FGADRLQRGEIRYNGEARAYRQPADAIADGIGLVAEDRKVDGIIPDMSIRENMTLALLPK
LARAGIVDRARQDEIVERYITALAIKCTSPDQPIKELSGGNQQKVLLGRWLCTDPKLLIV
DEPTRGIDIGAKSEILRLLRRLADEGLGVLMISSELEELLAAADRVTVLSDGTSVAVLPR
KELSEAALFAAMAHQVE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory