Comparing SM_b21374 FitnessBrowser__Smeli:SM_b21374 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
50% identity, 99% coverage: 1:311/313 of query aligns to 1:308/308 of 3iq0B
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
28% identity, 98% coverage: 3:310/313 of query aligns to 2:307/308 of 2dcnA
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
29% identity, 98% coverage: 1:308/313 of query aligns to 1:305/306 of 5eynA
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
29% identity, 98% coverage: 1:308/313 of query aligns to 5:309/310 of 5yggA
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
31% identity, 84% coverage: 4:265/313 of query aligns to 3:253/304 of 3ih0A
Sites not aligning to the query:
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
31% identity, 84% coverage: 4:265/313 of query aligns to 2:252/302 of 3gbuA
Sites not aligning to the query:
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
27% identity, 83% coverage: 52:310/313 of query aligns to 49:309/311 of 2varA
Sites not aligning to the query:
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
27% identity, 83% coverage: 52:310/313 of query aligns to 50:310/313 of Q97U29
Sites not aligning to the query:
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
29% identity, 100% coverage: 1:312/313 of query aligns to 1:305/309 of Q53W83
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
29% identity, 97% coverage: 1:305/313 of query aligns to 1:298/300 of 1v1bA
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
29% identity, 97% coverage: 1:305/313 of query aligns to 1:298/301 of 1v1aA
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
26% identity, 85% coverage: 47:312/313 of query aligns to 51:312/312 of 3in1A
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
28% identity, 85% coverage: 45:311/313 of query aligns to 48:305/306 of 4xckA
Sites not aligning to the query:
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
27% identity, 99% coverage: 1:311/313 of query aligns to 4:310/319 of Q8ZKR2
4wjmA Crystal structure of fructokinase from brucella abortus 2308 with bound amppnp
29% identity, 83% coverage: 4:262/313 of query aligns to 8:259/312 of 4wjmA
Sites not aligning to the query:
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
26% identity, 98% coverage: 4:311/313 of query aligns to 5:320/322 of 3lkiB
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
28% identity, 84% coverage: 47:308/313 of query aligns to 51:309/313 of 6ilsB
Sites not aligning to the query:
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 84% coverage: 47:308/313 of query aligns to 117:375/379 of A1A6H3
Sites not aligning to the query:
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
26% identity, 99% coverage: 2:311/313 of query aligns to 1:299/299 of 1tz3A
3kd6A Crystal structure of nucleoside kinase from chlorobium tepidum in complex with amp
27% identity, 78% coverage: 50:294/313 of query aligns to 42:278/300 of 3kd6A
Sites not aligning to the query:
>SM_b21374 FitnessBrowser__Smeli:SM_b21374
MHKILTIGEILVEIIATEKGDGFRKATPLIGPFPSGAPAIFIDQAGKLGQPCAIISRVGG
DDFGTVNLERLKRDGVDISGIEVDPLATTGSAFVRYRPDGSRAFVFNIRDSACGKITLDE
RMTRLVGECSHVHVMGSSLYAPSVVESILAAIGIVKAGGGTVSFDPNLRPEILKSPGMRE
ALLTVLAETDLFLPSGDELFLFTEAKTESQAVAELLASGIKAVVVKRGAAGASYFDAGAA
LSLPGFPVEEIDPTGAGDCFGATFVSFWLNGASPREALEFAAASGARAVMHFGPMEGAST
RAELERFISEQQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory