SitesBLAST
Comparing SM_b21376 FitnessBrowser__Smeli:SM_b21376 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
46% identity, 98% coverage: 7:500/503 of query aligns to 2:493/501 of P04983
- K43 (= K48) mutation to R: Loss of transport.
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 46% coverage: 9:239/503 of query aligns to 4:243/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 46% coverage: 9:239/503 of query aligns to 4:243/253 of 1g9xB
1g291 Malk (see paper)
27% identity, 68% coverage: 10:349/503 of query aligns to 4:326/372 of 1g291
- binding magnesium ion: D69 (≠ N77), E71 (≠ Q79), K72 (≠ E80), K79 (vs. gap), D80 (vs. gap), E292 (≠ A312), D293 (≠ A313)
- binding pyrophosphate 2-: S38 (≠ N44), G39 (= G45), C40 (≠ A46), G41 (= G47), K42 (= K48), T43 (≠ S49), T44 (= T50)
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
30% identity, 50% coverage: 10:259/503 of query aligns to 7:253/375 of 2d62A
4f4cA The crystal structure of the multi-drug transporter (see paper)
32% identity, 42% coverage: 21:229/503 of query aligns to 1035:1245/1250 of 4f4cA
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
32% identity, 42% coverage: 10:221/503 of query aligns to 3:209/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ F19), S37 (≠ N44), G38 (= G45), C39 (≠ A46), G40 (= G47), K41 (= K48), S42 (= S49), T43 (= T50), Q81 (= Q91), R128 (≠ E141), A132 (≠ N145), S134 (= S147), G136 (≠ A149), Q137 (= Q150), E158 (= E171), H191 (= H203)
- binding magnesium ion: S42 (= S49), Q81 (= Q91)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
32% identity, 42% coverage: 10:221/503 of query aligns to 3:209/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ F19), G38 (= G45), C39 (≠ A46), G40 (= G47), K41 (= K48), S42 (= S49), T43 (= T50), R128 (≠ E141), S134 (= S147), Q137 (= Q150)
- binding beryllium trifluoride ion: S37 (≠ N44), G38 (= G45), K41 (= K48), Q81 (= Q91), S134 (= S147), G136 (≠ A149), H191 (= H203)
- binding magnesium ion: S42 (= S49), Q81 (= Q91)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
32% identity, 42% coverage: 10:221/503 of query aligns to 3:209/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ F19), V17 (≠ A24), G38 (= G45), C39 (≠ A46), G40 (= G47), K41 (= K48), S42 (= S49), T43 (= T50), R128 (≠ E141), A132 (≠ N145), S134 (= S147), Q137 (= Q150)
- binding tetrafluoroaluminate ion: S37 (≠ N44), G38 (= G45), K41 (= K48), Q81 (= Q91), S134 (= S147), G135 (≠ I148), G136 (≠ A149), E158 (= E171), H191 (= H203)
- binding magnesium ion: S42 (= S49), Q81 (= Q91)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
32% identity, 42% coverage: 10:221/503 of query aligns to 3:209/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ F19), V17 (≠ A24), G38 (= G45), C39 (≠ A46), G40 (= G47), K41 (= K48), S42 (= S49), T43 (= T50), R128 (≠ E141), A132 (≠ N145), S134 (= S147), Q137 (= Q150)
- binding magnesium ion: S42 (= S49), Q81 (= Q91)
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
32% identity, 42% coverage: 10:221/503 of query aligns to 3:209/374 of 2awnB
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
32% identity, 42% coverage: 10:221/503 of query aligns to 4:210/371 of P68187
- A85 (≠ S94) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ N118) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ A126) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ I129) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ A131) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ P136) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (≠ A149) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D170) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
32% identity, 42% coverage: 10:221/503 of query aligns to 1:207/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ F19), S35 (≠ N44), G36 (= G45), C37 (≠ A46), G38 (= G47), K39 (= K48), S40 (= S49), T41 (= T50), R126 (≠ E141), A130 (≠ N145), S132 (= S147), G134 (≠ A149), Q135 (= Q150)
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
30% identity, 43% coverage: 9:224/503 of query aligns to 4:222/648 of P75831
- K47 (= K48) mutation to L: Lack of activity.
- D169 (= D170) mutation to N: Lack of activity.
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 44% coverage: 12:232/503 of query aligns to 4:223/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (= F19), V16 (≠ A24), S36 (≠ N44), G37 (= G45), S38 (≠ A46), G39 (= G47), K40 (= K48), S41 (= S49), T42 (= T50), E162 (= E171), H194 (= H203)
- binding magnesium ion: S41 (= S49), E162 (= E171)
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
29% identity, 45% coverage: 8:232/503 of query aligns to 2:229/615 of 5lilA
- binding adenosine-5'-triphosphate: F13 (= F19), V22 (≠ A24), S42 (≠ N44), G43 (= G45), G45 (= G47), K46 (= K48), S47 (= S49), T48 (= T50), Q92 (= Q91), K136 (≠ D138), Q143 (≠ N145), S145 (= S147), G147 (≠ A149), Q148 (= Q150)
- binding magnesium ion: S47 (= S49), Q92 (= Q91)
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
32% identity, 42% coverage: 10:221/503 of query aligns to 4:210/369 of P19566
- L86 (= L95) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P172) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D178) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
29% identity, 45% coverage: 8:232/503 of query aligns to 2:229/592 of 5lj7A
- binding adenosine-5'-triphosphate: V22 (≠ A24), S42 (≠ N44), G43 (= G45), G45 (= G47), K46 (= K48), S47 (= S49), T48 (= T50), Q92 (= Q91), K136 (≠ D138), Q143 (≠ N145), S145 (= S147), G147 (≠ A149), Q148 (= Q150)
- binding magnesium ion: S47 (= S49), Q92 (= Q91)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 45% coverage: 9:232/503 of query aligns to 1:228/343 of P30750
- 40:46 (vs. 44:50, 86% identical) binding
- E166 (= E171) mutation to Q: Exhibits little ATPase activity.
Sites not aligning to the query:
- 278:283 binding
- 295 N→A: Reduces the binding of L-methionine to undetectable levels.
- 295:296 binding
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
29% identity, 45% coverage: 9:232/503 of query aligns to 2:229/344 of 3tuzC
Sites not aligning to the query:
Query Sequence
>SM_b21376 FitnessBrowser__Smeli:SM_b21376
MHGSAADTILKITDVTKSFGQVAALKGMRLEVRRGRVHTLLGENGAGKSTLMKILAGVHG
ATSGEIVLDGQAYRPANPQEAASLGLAIVFQELSLCNNLTVAENILATREPRRFGFINDK
ALVAKAHRIVADLRLPIDVTEKVGNLSIAQRQLVEIAKGLSHDAKVVILDEPTSSLSDSE
AEILFEIIGRLRQRGAAIIYISHRMEEIMRLSDDITVIRDGEYVSTHARDEVTIETLIAL
MVGRRMDEIYPPPVHHVAADRAPVLAVDRLTREGEFQDVSFDVRAGEILGFFGLVGSGRS
EVMNALFGMKSAAGTVRLDGEVVRFRSPDQAIARGVGFVTENRKEEGLVLGHSVEWNISM
AALADFAGGLGFIRNGAERAAASEQVGKLSIKTNSLETPAGALSGGNQQKIVLAKWLLTR
PKVLILDEPTRGVDVGAKFEIYKIIRELAAEGTAILLISSDLPEVLGMSDRVVVMHEGAP
GATLEGSALTPETIMAHATGFQS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory