Comparing SM_b21377 FitnessBrowser__Smeli:SM_b21377 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
38% identity, 86% coverage: 28:283/296 of query aligns to 3:258/274 of 2ioyA
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
36% identity, 89% coverage: 26:288/296 of query aligns to 2:263/271 of 1dbpA
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
34% identity, 87% coverage: 28:285/296 of query aligns to 11:266/284 of 7e7mC
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
35% identity, 90% coverage: 28:294/296 of query aligns to 5:269/270 of 4zjpA
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
35% identity, 85% coverage: 32:284/296 of query aligns to 9:270/287 of 5dteB
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
31% identity, 87% coverage: 34:290/296 of query aligns to 10:272/292 of 2fn8A
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
35% identity, 79% coverage: 37:270/296 of query aligns to 12:246/305 of 3c6qC
Sites not aligning to the query:
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
35% identity, 79% coverage: 37:270/296 of query aligns to 12:246/313 of 2h3hA
Sites not aligning to the query:
4irxA Crystal structure of caulobacter myo-inositol binding protein bound to myo-inositol (see paper)
32% identity, 80% coverage: 37:274/296 of query aligns to 20:263/296 of 4irxA
6hyhA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-fucofuranose (see paper)
33% identity, 83% coverage: 45:290/296 of query aligns to 21:273/304 of 6hyhA
Sites not aligning to the query:
6hbmA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with alpha-l-arabinofuranose (see paper)
33% identity, 83% coverage: 45:290/296 of query aligns to 21:273/304 of 6hbmA
Sites not aligning to the query:
6hbdA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-galactofuranose (see paper)
33% identity, 83% coverage: 45:290/296 of query aligns to 22:274/305 of 6hbdA
Sites not aligning to the query:
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
30% identity, 69% coverage: 45:248/296 of query aligns to 53:258/349 of A0QYB5
Sites not aligning to the query:
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
30% identity, 69% coverage: 45:248/296 of query aligns to 21:226/315 of 4rsmA
Sites not aligning to the query:
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
30% identity, 85% coverage: 35:286/296 of query aligns to 12:264/287 of 5ibqA
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
30% identity, 85% coverage: 35:286/296 of query aligns to 12:264/287 of 4ry0A
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
31% identity, 71% coverage: 39:248/296 of query aligns to 14:225/314 of 5hkoA
Sites not aligning to the query:
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
31% identity, 71% coverage: 39:248/296 of query aligns to 47:258/349 of A0QYB3
Sites not aligning to the query:
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
31% identity, 71% coverage: 39:248/296 of query aligns to 14:225/315 of 4rs3A
Sites not aligning to the query:
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
30% identity, 86% coverage: 32:286/296 of query aligns to 8:274/288 of 1rpjA
>SM_b21377 FitnessBrowser__Smeli:SM_b21377
MNMPRILKTLVAGTALTLLASGAFADGIGASLLTQQHPFYIELAEAMKAEAKEKNVALEV
AIANQDLNKQLADVEDFIVKGVDVIVISPVDSQGVRAAIAKAEKAGIKVITVDVPANGAT
VTSHIGTDNFTGGVKAGELMAEVLGNKGKVAIIDYPTVQSVVNRVNGFKEAIAKHPEMEI
VATQTGITRAEALAAAQNMLQANPDITGIFGFGDDAALAAAVAVKAAGLESQVKVIGFDG
MKEARDAVDGNPVMVGVIQQFPDQMGKQAIDTAVKVVAGETVPAEQPIVPGVYTGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory