Comparing SM_b21438 FitnessBrowser__Smeli:SM_b21438 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
37% identity, 90% coverage: 32:331/332 of query aligns to 1:301/303 of 4pddA
4nq8B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate (see paper)
36% identity, 89% coverage: 32:325/332 of query aligns to 1:294/301 of 4nq8B
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
35% identity, 90% coverage: 32:331/332 of query aligns to 1:301/301 of 4pdhA
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
35% identity, 90% coverage: 31:329/332 of query aligns to 2:301/303 of 4p9kA
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
35% identity, 90% coverage: 31:329/332 of query aligns to 3:302/304 of 4pakA
4pcdA Crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans och 114 (rd1_1052, target efi-510238) with bound l-galactonate (see paper)
37% identity, 82% coverage: 29:300/332 of query aligns to 1:271/300 of 4pcdA
4pc9A Crystal structure of a trap periplasmic solute binding protein from rosenbacter denitrificans och 114 (rd1_1052, target efi-510238) with bound d-mannonate (see paper)
37% identity, 82% coverage: 29:300/332 of query aligns to 1:271/300 of 4pc9A
Q16BC9 Solute-binding protein RD1_1052 from Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans) (see paper)
37% identity, 88% coverage: 10:300/332 of query aligns to 8:295/325 of Q16BC9
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
35% identity, 90% coverage: 35:332/332 of query aligns to 8:309/310 of 7bbrA
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
35% identity, 90% coverage: 35:332/332 of query aligns to 7:308/310 of 7bcrA
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
35% identity, 90% coverage: 35:332/332 of query aligns to 7:308/310 of 7bcpA
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
35% identity, 90% coverage: 35:332/332 of query aligns to 7:308/310 of 7bcoA
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
35% identity, 90% coverage: 35:332/332 of query aligns to 7:308/310 of 7bcnA
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
34% identity, 85% coverage: 31:313/332 of query aligns to 2:285/304 of 4x8rA
4pf8A Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. Nas-14.1 (target efi-510299) with bound beta-d- galacturonate (see paper)
32% identity, 84% coverage: 54:332/332 of query aligns to 21:299/300 of 4pf8A
Sites not aligning to the query:
4p3lA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_2479), target efi-510085, with bound glucuronate, spg p6122 (see paper)
33% identity, 80% coverage: 49:313/332 of query aligns to 17:282/303 of 4p3lA
Sites not aligning to the query:
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
32% identity, 91% coverage: 12:312/332 of query aligns to 4:306/329 of P44542
2v4cA Structure of sialic acid binding protein (siap) in the presence of kdn (see paper)
33% identity, 85% coverage: 31:312/332 of query aligns to 1:283/309 of 2v4cA
3b50A Structure of h. Influenzae sialic acid binding protein bound to neu5ac. (see paper)
33% identity, 85% coverage: 31:312/332 of query aligns to 1:283/310 of 3b50A
2wx9A Crystal structure of the sialic acid binding periplasmic protein siap (see paper)
33% identity, 85% coverage: 31:312/332 of query aligns to 1:283/308 of 2wx9A
>SM_b21438 FitnessBrowser__Smeli:SM_b21438
MKLGISKISRGLAATVIAGIVGLSAHSAAMAETTIRLGHVLADTHSWHKASTDFAKEVSE
KTEGRVKIEIFPSGQLGTEKEVIEGMQIGTIQGGLIGSGSFQFVEPKFGIIEMPYAWTSR
EQAFAALDGKLGTALADLLRPKGIEVLAWWENGFRNITNNKHPIVKPADLAGIKIRVTPD
KVRLATFERLGAQPAPLAFGELYSALQQGVFDAQENPLSIIDASSFYEVQKYVSMTGHIW
GAACLTVSSMTWAQVSPEDQAIVKEAAVKWGNAQRQMVADNEVALIEKLKSKGMQFNEVD
KAAFVDALKPIWESEKDVFGPELLEVMDSYRK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory