Comparing SM_b21463 FitnessBrowser__Smeli:SM_b21463 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
5c3mB Crystal structure of gan4c, a gh4 6-phospho-glucosidase from geobacillus stearothermophilus
31% identity, 99% coverage: 1:455/461 of query aligns to 1:405/411 of 5c3mB
1up7A Structure of the 6-phospho-beta glucosidase from thermotoga maritima at 2.4 angstrom resolution in the tetragonal form with NAD and glucose-6-phosphate (see paper)
29% identity, 99% coverage: 1:457/461 of query aligns to 3:411/414 of 1up7A
1up6A Structure of the 6-phospho-beta glucosidase from thermotoga maritima at 2.55 angstrom resolution in the tetragonal form with manganese, NAD+ and glucose-6-phosphate (see paper)
29% identity, 99% coverage: 1:457/461 of query aligns to 2:410/413 of 1up6A
6dvvA 2.25 angstrom resolution crystal structure of 6-phospho-alpha- glucosidase from klebsiella pneumoniae in complex with NAD and mn2+. (see paper)
26% identity, 100% coverage: 1:459/461 of query aligns to 4:433/435 of 6dvvA
P54716 Maltose-6'-phosphate glucosidase; 6-phospho-alpha-D-glucosidase; 6-phosphoryl-O-alpha-D-glucopyranosyl:phosphoglucohydrolase; EC 3.2.1.122 from Bacillus subtilis (strain 168) (see paper)
25% identity, 100% coverage: 1:459/461 of query aligns to 6:440/449 of P54716
1u8xX Crystal structure of glva from bacillus subtilis, a metal-requiring, NAD-dependent 6-phospho-alpha-glucosidase (see paper)
24% identity, 100% coverage: 1:459/461 of query aligns to 4:431/436 of 1u8xX
Q97LM4 Maltose-6'-phosphate glucosidase MalH; 6-phospho-alpha-glucosidase; 6-phospho-glucosidase; Maltose-6-phosphate hydrolase; EC 3.2.1.122 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
22% identity, 99% coverage: 3:459/461 of query aligns to 6:439/441 of Q97LM4
6wbtA 2.52 angstrom resolution crystal structure of 6-phospho-alpha- glucosidase from gut microorganisms in complex with NAD and glucose- 6-phosphate
24% identity, 100% coverage: 1:459/461 of query aligns to 4:440/442 of 6wbtA
6vc6B 2.1 angstrom resolution crystal structure of 6-phospho-alpha- glucosidase from gut microorganisms in complex with NAD and mn2+
23% identity, 97% coverage: 3:447/461 of query aligns to 5:426/440 of 6vc6B
3u95A Crystal structure of a putative alpha-glucosidase from thermotoga neapolitana (see paper)
22% identity, 98% coverage: 1:451/461 of query aligns to 1:456/468 of 3u95A
7br4A Structure of deletion mutant of alpha-glucuronidase (tm0752) from thermotoga maritima (see paper)
24% identity, 97% coverage: 1:448/461 of query aligns to 2:453/468 of 7br4A
7ctmA Crystal structure of thermotoga maritima alpha-glucuronidase (tm0752) in complex with nadh and d-glucuronic acid (see paper)
24% identity, 97% coverage: 1:448/461 of query aligns to 2:454/469 of 7ctmA
1vjtA Crystal structure of alpha-glucosidase (tm0752) from thermotoga maritima at 2.50 a resolution
24% identity, 97% coverage: 1:448/461 of query aligns to 3:455/471 of 1vjtA
6kcxA Crystal structure of citrate complex of alpha-glucuronidase (tm0752) from thermotoga maritima (see paper)
24% identity, 97% coverage: 1:448/461 of query aligns to 2:454/470 of 6kcxA
Q9AI65 Alpha-glucosidase; EC 3.2.1.20 from Erwinia rhapontici (Pectobacterium rhapontici) (see paper)
27% identity, 43% coverage: 2:197/461 of query aligns to 4:203/453 of Q9AI65
Sites not aligning to the query:
P39130 Alpha-galacturonidase; EC 3.2.1.67 from Bacillus subtilis (strain 168) (see paper)
28% identity, 29% coverage: 69:203/461 of query aligns to 74:218/446 of P39130
3fefA Crystal structure of putative glucosidase lpld from bacillus subtilis
28% identity, 29% coverage: 69:203/461 of query aligns to 68:212/434 of 3fefA
O33830 Alpha-glucosidase; Maltase; EC 3.2.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
23% identity, 47% coverage: 1:215/461 of query aligns to 4:222/480 of O33830
1obbA Alpha-glucosidase a, agla, from thermotoga maritima in complex with maltose and NAD+ (see paper)
23% identity, 47% coverage: 1:215/461 of query aligns to 3:221/478 of 1obbA
Sites not aligning to the query:
>SM_b21463 FitnessBrowser__Smeli:SM_b21463
MKLTLIGGGGVRAPLFVGSALRRAERSGLSEICLQDINERKLELFGRISQELARRTQSPV
RITMAADAERALDGARYVVTTVRPGNEDGRIKDERIALAHGVLGQETTGPGGFAMALRSI
PVILKYAEILKKVSPDAWLFNFTNPAGLVTQALQNEGYHRTVGICDGANGAQEALAHWHK
VQQNDVRCEVYGLNHLSFTRRATIDGKEVLQPLLDDDGFLRSTSQRMFDASLIRSQRNWI
NEYLYYYYYAEKAVEALKADARTRGEEVKDLNAALITRLSAMDLNADAERRSPPNYAYER
RRNATYMHYALTDAPSMEEADRLVEGLAAAQTGEEGEGYAGVALNLVDALETGKPCYTGL
NVRNEGAIEGLRNDDVVEVSCLVDGEGIRPLKIGAMPEAQSQIVHNVKRYERLAVRAIRE
RSRDLAVQALMAHPLVLSYSRAVPLVDEYLAAHAEFAGEWS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory