SitesBLAST
Comparing SM_b21494 FitnessBrowser__Smeli:SM_b21494 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q88H32 Ornithine cyclodeaminase; OCD; EC 4.3.1.12 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
56% identity, 94% coverage: 11:342/355 of query aligns to 1:334/350 of Q88H32
- R45 (= R55) binding
- K69 (= K79) binding
- T84 (= T94) binding
- R112 (= R122) binding ; binding
- AQ 139:140 (= AQ 149:150) binding
- D161 (= D171) binding
- T202 (= T211) binding
- VGGD 225:228 (≠ IGGD 234:237) binding
- D228 (= D237) binding
- K232 (= K241) binding
- S293 (= S302) binding
- V294 (= V303) binding
- K331 (≠ R339) binding
1x7dA Crystal structure analysis of ornithine cyclodeaminase complexed with NAD and ornithine to 1.6 angstroms (see paper)
56% identity, 93% coverage: 14:342/355 of query aligns to 3:333/340 of 1x7dA
- active site: E55 (= E66), D227 (= D237)
- binding nicotinamide-adenine-dinucleotide: T83 (= T94), R111 (= R122), T112 (= T123), G137 (= G148), A138 (= A149), Q139 (= Q150), D160 (= D171), T161 (≠ I172), V200 (≠ C210), T201 (= T211), A202 (= A212), I209 (= I219), V224 (≠ I234), G225 (= G235), D227 (= D237), K231 (= K241), S292 (= S302), V293 (= V303), G294 (= G304)
- binding L-ornithine: R44 (= R55), V53 (= V64), E55 (= E66), M57 (= M68), K68 (= K79), V70 (= V81), N71 (= N82), G72 (= G83), R111 (= R122), D227 (= D237), V293 (= V303)
1u7hA Structure and a proposed mechanism for ornithine cyclodeaminase from pseudomonas putida (see paper)
56% identity, 93% coverage: 14:342/355 of query aligns to 3:333/341 of 1u7hA
- active site: E55 (= E66), D227 (= D237)
- binding nicotinamide-adenine-dinucleotide: T83 (= T94), R111 (= R122), T112 (= T123), G137 (= G148), A138 (= A149), Q139 (= Q150), D160 (= D171), T161 (≠ I172), V200 (≠ C210), T201 (= T211), A202 (= A212), I209 (= I219), V224 (≠ I234), G225 (= G235), D227 (= D237), K231 (= K241), S292 (= S302), V293 (= V303), G294 (= G304)
1omoA Alanine dehydrogenase dimer w/bound NAD (archaeal) (see paper)
32% identity, 79% coverage: 35:316/355 of query aligns to 19:304/320 of 1omoA
- active site: R52 (≠ E66), D219 (= D237)
- binding nicotinamide-adenine-dinucleotide: T109 (= T123), G134 (= G148), T135 (≠ A149), Q136 (= Q150), Y156 (= Y170), D157 (= D171), V158 (≠ I172), R159 (≠ D173), T195 (≠ C210), P196 (≠ T211), G217 (= G235), D219 (= D237), K223 (= K241), S290 (= S302), T291 (≠ V303), G292 (= G304)
O28608 Alanine dehydrogenase; AlaDH; EC 1.4.1.1 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
32% identity, 79% coverage: 35:316/355 of query aligns to 19:304/322 of O28608
6t3eB Structure of thermococcus litoralis delta(1)-pyrroline-2-carboxylate reductase in complex with nadh and l-proline (see paper)
33% identity, 70% coverage: 62:309/355 of query aligns to 48:303/325 of 6t3eB
- binding 1,4-dihydronicotinamide adenine dinucleotide: S82 (≠ T94), T111 (= T123), G136 (= G148), V137 (≠ A149), Q138 (= Q150), D159 (= D171), I160 (= I172), A199 (≠ C210), T200 (= T211), T201 (≠ A212), A202 (≠ D213), V206 (≠ I219), V221 (≠ I234), G222 (= G235), W223 (≠ G236), S296 (= S302), V297 (= V303), G298 (= G304)
- binding proline: M54 (= M68), K67 (= K79), R110 (= R122)
Sites not aligning to the query:
5gzlA Cyclodeaminase_pa
35% identity, 71% coverage: 63:313/355 of query aligns to 64:316/357 of 5gzlA
- binding lysine: I65 (≠ V64), E67 (= E66), D240 (= D237), R267 (≠ I264), E268 (= E265)
- binding nicotinamide-adenine-dinucleotide: Y85 (≠ G83), T97 (= T94), I98 (≠ V95), T126 (= T123), G151 (= G148), A152 (= A149), Q153 (= Q150), D174 (= D171), T175 (≠ I172), H179 (≠ A176), A212 (≠ T209), T213 (≠ C210), S214 (≠ T211), V222 (≠ I219), V237 (≠ I234), G238 (= G235), A239 (≠ G236), D240 (= D237), K244 (= K241), S305 (= S302), T306 (≠ V303), G307 (= G304)
Sites not aligning to the query:
5gziA Cyclodeaminase_pa
35% identity, 71% coverage: 63:313/355 of query aligns to 64:316/354 of 5gziA
- binding nicotinamide-adenine-dinucleotide: Y85 (≠ G83), T97 (= T94), R125 (= R122), T126 (= T123), G151 (= G148), A152 (= A149), Q153 (= Q150), D174 (= D171), T175 (≠ I172), H179 (≠ A176), A212 (≠ T209), T213 (≠ C210), S214 (≠ T211), V215 (≠ A212), V237 (≠ I234), G238 (= G235), A239 (≠ G236), S305 (= S302), T306 (≠ V303), G307 (= G304)
- binding (2S)-piperidine-2-carboxylic acid: K81 (= K79), R125 (= R122), A239 (≠ G236), T306 (≠ V303), G307 (= G304)
Sites not aligning to the query:
5yu4A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
35% identity, 71% coverage: 63:313/355 of query aligns to 60:312/344 of 5yu4A
- binding 2,4-diaminobutyric acid: E63 (= E66), K77 (= K79), R121 (= R122), T302 (≠ V303), G303 (= G304)
- binding nicotinamide-adenine-dinucleotide: Y81 (≠ G83), T93 (= T94), I94 (≠ V95), R121 (= R122), T122 (= T123), G147 (= G148), A148 (= A149), Q149 (= Q150), D170 (= D171), T171 (≠ I172), H175 (≠ A176), A208 (≠ T209), T209 (≠ C210), S210 (≠ T211), V211 (≠ A212), V218 (≠ I219), V233 (≠ I234), A235 (≠ G236), S301 (= S302), T302 (≠ V303), G303 (= G304)
5yu3A Structural basis for recognition of l-lysine, l-ornithine, and l-2,4- diamino butyric acid by lysine cyclodeaminase (see paper)
35% identity, 71% coverage: 63:313/355 of query aligns to 60:312/344 of 5yu3A
- binding nicotinamide-adenine-dinucleotide: Y81 (≠ G83), T93 (= T94), I94 (≠ V95), T122 (= T123), G147 (= G148), A148 (= A149), Q149 (= Q150), D170 (= D171), T171 (≠ I172), A208 (≠ T209), T209 (≠ C210), S210 (≠ T211), V211 (≠ A212), V233 (≠ I234), A235 (≠ G236), S301 (= S302), T302 (≠ V303), G303 (= G304)
- binding proline: M65 (= M68), K77 (= K79), R121 (= R122)
6rqaB Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
31% identity, 65% coverage: 85:316/355 of query aligns to 75:307/322 of 6rqaB
- binding Tb-Xo4: N76 (≠ K86)
- binding nicotinamide-adenine-dinucleotide: T113 (= T123), G138 (= G148), Q140 (= Q150), P162 (≠ I172), H163 (≠ D173), I199 (≠ A212), T200 (≠ D213), S201 (≠ K214), S202 (≠ Q215), M221 (≠ I234), G222 (= G235), D224 (= D237), K228 (= K241), G293 (≠ S302), T294 (≠ V303), G295 (= G304)
Sites not aligning to the query:
6rqaA Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
31% identity, 65% coverage: 85:316/355 of query aligns to 75:307/322 of 6rqaA
- binding nicotinamide-adenine-dinucleotide: H85 (≠ V95), T113 (= T123), G138 (= G148), H139 (≠ A149), Q140 (= Q150), N161 (≠ D171), P162 (≠ I172), H163 (≠ D173), M166 (≠ A176), I199 (≠ A212), T200 (≠ D213), S201 (≠ K214), S202 (≠ Q215), M221 (≠ I234), G222 (= G235), D224 (= D237), K228 (= K241), G293 (≠ S302)
A1B8Z0 Iminosuccinate reductase; EC 1.4.1.- from Paracoccus denitrificans (strain Pd 1222) (see paper)
31% identity, 65% coverage: 85:316/355 of query aligns to 73:305/320 of A1B8Z0
4m54A The structure of the staphyloferrin b precursor biosynthetic enzyme sbnb bound to n-(1-amino-1-carboxyl-2-ethyl)-glutamic acid and nadh (see paper)
26% identity, 74% coverage: 54:316/355 of query aligns to 44:294/310 of 4m54A
- active site: I55 (= I65), M231 (≠ T242)
- binding N-[(2S)-2-amino-2-carboxyethyl]-L-glutamic acid: Y45 (≠ R55), R53 (≠ G63), M57 (= M68), K71 (= K79), I73 (≠ V81), R87 (≠ T94), R115 (= R122)
- binding 1,4-dihydronicotinamide adenine dinucleotide: R87 (≠ T94), T116 (= T123), G141 (= G148), L142 (≠ A149), I143 (≠ Q150), D165 (= D171), Q166 (≠ R175), T207 (= T211), T209 (≠ D213), I228 (= I234)
4mp6A Staphyloferrin b precursor biosynthetic enzyme sbnb bound to citrate and NAD+ (see paper)
26% identity, 73% coverage: 59:316/355 of query aligns to 54:318/334 of 4mp6A
- active site: I60 (= I65), M236 (≠ T242)
- binding nicotinamide-adenine-dinucleotide: R92 (≠ T94), R120 (= R122), T121 (= T123), G146 (= G148), L147 (≠ A149), I148 (≠ Q150), D170 (= D171), Q171 (≠ R175), C211 (= C210), T212 (= T211), V213 (≠ A212), I233 (= I234), G306 (= G304)
4mpdA Staphyloferrin b precursor biosynthetic enzyme sbnb bound a- ketoglutarate and NAD+ (see paper)
26% identity, 66% coverage: 84:316/355 of query aligns to 70:302/318 of 4mpdA
- active site: M224 (≠ T242)
- binding 2-oxoglutaric acid: R80 (≠ T94), M289 (≠ V303)
- binding nicotinamide-adenine-dinucleotide (acidic form): R80 (≠ T94), R108 (= R122), T109 (= T123), G134 (= G148), I136 (≠ Q150), D158 (= D171), Q159 (≠ R175), F160 (≠ A176), T200 (= T211), V201 (≠ A212), I221 (= I234)
Sites not aligning to the query:
4bvaA Crystal structure of the NADPH-t3 form of mouse mu-crystallin. (see paper)
29% identity, 61% coverage: 100:316/355 of query aligns to 87:296/303 of 4bvaA
- active site: S219 (≠ D237)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T106 (= T119), R109 (= R122), T110 (= T123), G135 (= G148), V136 (≠ A149), Q137 (= Q150), N158 (≠ D171), R159 (≠ I172), T160 (≠ D173), N163 (≠ A176), V194 (≠ C210), T195 (= T211), M196 (≠ A212), A197 (≠ D213), V216 (≠ I234), S282 (= S302), L283 (≠ V303), G284 (= G304)
- binding 3,5,3'triiodothyronine: S219 (≠ D237), R220 (≠ C238), W223 (≠ K241), E247 (= E265)
Sites not aligning to the query:
4bv9A Crystal structure of the NADPH form of mouse mu-crystallin. (see paper)
29% identity, 61% coverage: 100:316/355 of query aligns to 88:297/303 of 4bv9A
- active site: S220 (≠ D237)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T111 (= T123), G134 (= G146), G136 (= G148), V137 (≠ A149), Q138 (= Q150), N159 (≠ D171), R160 (≠ I172), T161 (≠ D173), V195 (≠ C210), T196 (= T211), M197 (≠ A212), A198 (≠ D213), V217 (≠ I234), G218 (= G235), S283 (= S302), L284 (≠ V303), G285 (= G304)
- binding pyruvic acid: R110 (= R122)
Sites not aligning to the query:
Q14894 Ketimine reductase mu-crystallin; NADP-regulated thyroid-hormone-binding protein; EC 1.5.1.25 from Homo sapiens (Human) (see paper)
28% identity, 61% coverage: 100:316/355 of query aligns to 97:306/314 of Q14894
2i99A Crystal structure of human mu_crystallin at 2.6 angstrom (see paper)
28% identity, 61% coverage: 100:316/355 of query aligns to 96:305/312 of 2i99A
- active site: S228 (≠ D237)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R118 (= R122), T119 (= T123), G142 (= G146), A143 (≠ N147), G144 (= G148), V145 (≠ A149), Q146 (= Q150), N167 (≠ D171), R168 (≠ I172), T169 (≠ D173), V203 (≠ C210), T204 (= T211), L205 (≠ A212), A206 (≠ D213), V225 (≠ I234), G226 (= G235), S291 (= S302), L292 (≠ V303), G293 (= G304)
Sites not aligning to the query:
Query Sequence
>SM_b21494 FitnessBrowser__Smeli:SM_b21494
MFSPLPSAKAMVPFVSVDNMMRLVHHLGIETVLAELTDTIEADFRRWESFDKTPRVASHS
RDGVIELMPTSDGRVYSFKYVNGHPKNTAEGLQTVTAFGLLAEVSTGYPALLTEMTILTA
LRTAATSAMAARHLAPKGARTMAMIGNGAQAEFQALAMKAVCGIDTIRLYDIDPRATEKA
ARNLDGSGLKILSCRSAQEAIEGAEIVTTCTADKQFATILTDNMVGAGVHINAIGGDCPG
KTELHRDILQRSDVFVEYPPQTRIEGEIQQMAPDFPVTELWKVVTGEAQGRRDGRQITLF
DSVGFAIEDFSALRYVRARLPGTDFYQNLDMIADPDDPRDLFGMLLRAKENEETI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory